(data stored in ACNUC6288 zone)

EMBL: CR382138.PE131

CR382138.PE131       Location/Qualifiers
FT   CDS             complement(271020..272102)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03080g"
FT                   /old_locus_tag="DEHA0F03476g"
FT                   /old_locus_tag="DEHA-IPF8848"
FT                   /old_locus_tag="DEHA-CDS4106.1"
FT                   /product="DEHA2F03080p"
FT                   /note="weakly similar to uniprot|Q06991 Saccharomyces
FT                   cerevisiae YLR414C Protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03080g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88813"
FT                   /db_xref="GOA:Q6BMS1"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMS1"
FT                   /protein_id="CAG88813.1"
FT                   /translation="MFRIVRLIIILLSIATTVLSIFALVGSYKNEAYLTKIYLLDFHLT
FT                   DLDVSQLIDFNGFSKRDTIHPDSKRDTILPGRTVVEKDLASSLSDIGSTISGIVNSITY
FT                   EDMGLAQVYSISLWGYCKGEVKGSSKTEKGFDNSDIDFKWCSDPKPAYFFDPLEIIKQE
FT                   LNNTINDKITGASGSIDISSDVRTVLEQIVDNITYETLNLPGNLNKQLTLLNNLTKAAF
FT                   ALILIMAILSAIGVFVQLIGCCVDPSNCCLSCINFLFQTLVFLTGIIGAGLATGAYIYV
FT                   RKQINENTGELGIKSFLSIAFYALIWSAVAAALLVLIFTIIGHCCGCLSNNRKKYKPLD
FT                   APAVPEKNGYEMGYNHHQNY"
     MFRIVRLIII LLSIATTVLS IFALVGSYKN EAYLTKIYLL DFHLTDLDVS QLIDFNGFSK        60
     RDTIHPDSKR DTILPGRTVV EKDLASSLSD IGSTISGIVN SITYEDMGLA QVYSISLWGY       120
     CKGEVKGSSK TEKGFDNSDI DFKWCSDPKP AYFFDPLEII KQELNNTIND KITGASGSID       180
     ISSDVRTVLE QIVDNITYET LNLPGNLNKQ LTLLNNLTKA AFALILIMAI LSAIGVFVQL       240
     IGCCVDPSNC CLSCINFLFQ TLVFLTGIIG AGLATGAYIY VRKQINENTG ELGIKSFLSI       300
     AFYALIWSAV AAALLVLIFT IIGHCCGCLS NNRKKYKPLD APAVPEKNGY EMGYNHHQNY       360
//

If you have problems or comments...

PBIL Back to PBIL home page