(data stored in ACNUC6288 zone)

EMBL: CR382138.PE132

CR382138.PE132       Location/Qualifiers
FT   CDS             complement(272630..275017)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03102g"
FT                   /old_locus_tag="DEHA0F03498g"
FT                   /old_locus_tag="DEHA-IPF8845"
FT                   /old_locus_tag="DEHA-CDS0851.1"
FT                   /product="DEHA2F03102p"
FT                   /note="similar to p|Q03254 uniprot|Q03254 Saccharomyces
FT                   cerevisiae YMR277W FCP1 Carboxy-terminal domain (CTD)
FT                   phosphatase essential for dephosphorylation of the repeated
FT                   C-terminal domain of the RNA polymerase II large subunit
FT                   (Rpo21p)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03102g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88814"
FT                   /db_xref="GOA:Q6BMS0"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011947"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR039189"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMS0"
FT                   /protein_id="CAG88814.2"
FT                   /translation="MAELTSITLPQSVPFPVTISSILCRQGETVPKHQTLFKYKYWDYQ
FT                   DDPNSKEETPPKIRVERIGTYESPIEGEVNSINVCLSDEIAHSGVELCFIKEPCAHAVQ
FT                   YGGLCALCGKAVEDEKDYSGYNYEDRATISMSHDNTGLKISLDEATKIEHNTTDRLSRE
FT                   KKLILVVDLDQTVIHATVDPTVGEWQSDPSNPNYPAVKNVRSFCLEEDPIAPPGWTGPK
FT                   LPPSKCWYYVKLRPGLEEFLRSASDLYEMHIYTMATRNYALAIAKIIDPEGEYFGDRIL
FT                   SRDESGSLTHKNLKRLFPVDQSMVVIIDDRGDVWQWENNLIKVVPYDFFVGIGDINSSF
FT                   LPKKFGQLTGPTKKRKSIAKLEALENEKNSTDDEESEANENDKEASEEDDNPSQENDTP
FT                   SSSPVDRILEMGGGEDNASLLMEQSISRNMSLEQQQHDRPLAKLQHDLDKIHEHDSHSP
FT                   SGSSSPEESDGDKKEEEDEEEDNLLYDDDNELYSLKKALVRIHSEYYKILAANKIKSPH
FT                   LKPDLTHIIPFLKSKCLEGITILFSGILPLGINLDTADIVIWCKQFGVKVVNEVYPEVT
FT                   HVVCRDPNANSFKSGPTFKVRVAKKILPNVKIVNPDWLFACLSAWGKVDETDYLVESEE
FT                   DNWYLEDKDLKKYQKGLESQKQKQINTIESRPRFDSIGSVEEYDLDNANQEVDDFLAGI
FT                   SEDDNSEKDDDDNDNDDDNNDNEDTDNDKAEVSKPFDSFIKDAYKVNKKRSLEADEDII
FT                   LQQEVTSKKQKTQQAEPESEVDLDELEKELLDGFDDMEEANV"
     MAELTSITLP QSVPFPVTIS SILCRQGETV PKHQTLFKYK YWDYQDDPNS KEETPPKIRV        60
     ERIGTYESPI EGEVNSINVC LSDEIAHSGV ELCFIKEPCA HAVQYGGLCA LCGKAVEDEK       120
     DYSGYNYEDR ATISMSHDNT GLKISLDEAT KIEHNTTDRL SREKKLILVV DLDQTVIHAT       180
     VDPTVGEWQS DPSNPNYPAV KNVRSFCLEE DPIAPPGWTG PKLPPSKCWY YVKLRPGLEE       240
     FLRSASDLYE MHIYTMATRN YALAIAKIID PEGEYFGDRI LSRDESGSLT HKNLKRLFPV       300
     DQSMVVIIDD RGDVWQWENN LIKVVPYDFF VGIGDINSSF LPKKFGQLTG PTKKRKSIAK       360
     LEALENEKNS TDDEESEANE NDKEASEEDD NPSQENDTPS SSPVDRILEM GGGEDNASLL       420
     MEQSISRNMS LEQQQHDRPL AKLQHDLDKI HEHDSHSPSG SSSPEESDGD KKEEEDEEED       480
     NLLYDDDNEL YSLKKALVRI HSEYYKILAA NKIKSPHLKP DLTHIIPFLK SKCLEGITIL       540
     FSGILPLGIN LDTADIVIWC KQFGVKVVNE VYPEVTHVVC RDPNANSFKS GPTFKVRVAK       600
     KILPNVKIVN PDWLFACLSA WGKVDETDYL VESEEDNWYL EDKDLKKYQK GLESQKQKQI       660
     NTIESRPRFD SIGSVEEYDL DNANQEVDDF LAGISEDDNS EKDDDDNDND DDNNDNEDTD       720
     NDKAEVSKPF DSFIKDAYKV NKKRSLEADE DIILQQEVTS KKQKTQQAEP ESEVDLDELE       780
     KELLDGFDDM EEANV                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page