(data stored in ACNUC6288 zone)

EMBL: CR382138.PE133

CR382138.PE133       Location/Qualifiers
FT   CDS             complement(275252..277345)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03124g"
FT                   /old_locus_tag="DEHA0F03520g"
FT                   /old_locus_tag="DEHA-IPF8841"
FT                   /old_locus_tag="DEHA-CDS1139.1"
FT                   /product="DEHA2F03124p"
FT                   /note="weakly similar to uniprot|Q03750 Saccharomyces
FT                   cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved in
FT                   RNA polymerase II transcription initiation"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03124g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88815"
FT                   /db_xref="InterPro:IPR019473"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMR9"
FT                   /protein_id="CAG88815.2"
FT                   /translation="MVSEDKAADIKKEEQSNSTINSAQDDVQNKHHEADETKEDMIRSN
FT                   NNENEEKDINSDGQEEKKADISEKLNGHEVITIDNKSTQNESEASNADDTVMNTETINK
FT                   KGEEVPINISNNDKETHFNKPVLNLPDLEVPFSERRLAPETINLLNKPVDKKLAMSGIE
FT                   FQFSKIIGVILKSKGLDYSEEFLSQMNDLSITYFHDIIEMLRKFTEVQRRKKPSISDTE
FT                   LCFRMKGIKAGKLYKEYEETKLIAKKYKSEIDLVNSQTTELINEFKEDNKFDENDPSLP
FT                   FFTNEHYEITELIPKQSSKPIYIPFYLPELPPDYTYQKTPKYMNMITDLKQLRLKLVDE
FT                   SRLTEKSLYNLIDDDEKKWKEDFEKQIRDTLSEVDDDIDSENENSLMSEVEQKNQTDIE
FT                   TPIPDHQLEEHETKPRPTELNTKDGIPDEVDAASETLHNKTEEQIAKVDGEPRKLLQDV
FT                   KTFDFVAYAQKRRDLERSKELKIDRKRKLRESNIFFKTEKYYSPYATLPVTPEVDLFFA
FT                   NIVQEEFKSVIGSVRTAEKRKKRKVENILREKAEREQAKEKEREKMGLGFSFGPISHMS
FT                   DDDNDDSDRDEDMGFPTFDFGDSNGSQDKQETDANPNNNNNFPLDNNETEIGSVPKADG
FT                   TDAAHVNINTDEEMDSDSFEAELEDAIPADSAPKVTLLENNMKISNDLPSDSSDDEIEL
FT                   EDV"
     MVSEDKAADI KKEEQSNSTI NSAQDDVQNK HHEADETKED MIRSNNNENE EKDINSDGQE        60
     EKKADISEKL NGHEVITIDN KSTQNESEAS NADDTVMNTE TINKKGEEVP INISNNDKET       120
     HFNKPVLNLP DLEVPFSERR LAPETINLLN KPVDKKLAMS GIEFQFSKII GVILKSKGLD       180
     YSEEFLSQMN DLSITYFHDI IEMLRKFTEV QRRKKPSISD TELCFRMKGI KAGKLYKEYE       240
     ETKLIAKKYK SEIDLVNSQT TELINEFKED NKFDENDPSL PFFTNEHYEI TELIPKQSSK       300
     PIYIPFYLPE LPPDYTYQKT PKYMNMITDL KQLRLKLVDE SRLTEKSLYN LIDDDEKKWK       360
     EDFEKQIRDT LSEVDDDIDS ENENSLMSEV EQKNQTDIET PIPDHQLEEH ETKPRPTELN       420
     TKDGIPDEVD AASETLHNKT EEQIAKVDGE PRKLLQDVKT FDFVAYAQKR RDLERSKELK       480
     IDRKRKLRES NIFFKTEKYY SPYATLPVTP EVDLFFANIV QEEFKSVIGS VRTAEKRKKR       540
     KVENILREKA EREQAKEKER EKMGLGFSFG PISHMSDDDN DDSDRDEDMG FPTFDFGDSN       600
     GSQDKQETDA NPNNNNNFPL DNNETEIGSV PKADGTDAAH VNINTDEEMD SDSFEAELED       660
     AIPADSAPKV TLLENNMKIS NDLPSDSSDD EIELEDV                                697
//

If you have problems or comments...

PBIL Back to PBIL home page