(data stored in ACNUC6288 zone)

EMBL: CR382138.PE139

CR382138.PE139       Location/Qualifiers
FT   CDS             join(283536..283560,283638..284149)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03256g"
FT                   /old_locus_tag="DEHA0F03630g"
FT                   /product="DEHA2F03256p"
FT                   /note="weakly similar to uniprot|P34232 Saccharomyces
FT                   cerevisiae YKL186C MTR2 mRNA transport regulator essential
FT                   nuclear protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03256g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88820"
FT                   /db_xref="GOA:Q6BMR4"
FT                   /db_xref="InterPro:IPR019488"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMR4"
FT                   /protein_id="CAG88820.1"
FT                   /translation="MSNIQRDPKPYLKKILSSLDIQYQGPSQQFPNVESYATQFGKQLK
FT                   PQCAIIMNGKPLIPTNNDAKLEFQKKWLLSPLTFHQLNSFDSHLIPGTGTFVINASGKV
FT                   KFDESGRNRLGETSDLIHPINNATVKGRPVWGSWFGFNLNLIVDESILNNPESEAINSY
FT                   NYRFTYKPDDSVIQI"
     MSNIQRDPKP YLKKILSSLD IQYQGPSQQF PNVESYATQF GKQLKPQCAI IMNGKPLIPT        60
     NNDAKLEFQK KWLLSPLTFH QLNSFDSHLI PGTGTFVINA SGKVKFDESG RNRLGETSDL       120
     IHPINNATVK GRPVWGSWFG FNLNLIVDES ILNNPESEAI NSYNYRFTYK PDDSVIQI         178
//

If you have problems or comments...

PBIL Back to PBIL home page