(data stored in ACNUC6288 zone)

EMBL: CR382138.PE143

CR382138.PE143       Location/Qualifiers
FT   CDS             complement(290147..291370)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03344g"
FT                   /old_locus_tag="DEHA0F03718g"
FT                   /old_locus_tag="DEHA-IPF8824"
FT                   /old_locus_tag="DEHA-CDS3035.1"
FT                   /product="DEHA2F03344p"
FT                   /note="some similarities with uniprot|P42933 Saccharomyces
FT                   cerevisiae YMR191W SPG5 Protein required for survival at
FT                   high temperature during stationary phase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03344g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88824"
FT                   /db_xref="GOA:Q6BMR0"
FT                   /db_xref="InterPro:IPR038816"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMR0"
FT                   /protein_id="CAG88824.2"
FT                   /translation="MRSQTMKNLISLKKNITRRIKQTLEEIAENLGHPQQRPVPVPIPI
FT                   PVRSGRNASRLSKQFSRYYSTSSNFTGGHYKFRAFQFLNVKYQNGGKLGRIIQNNSNWI
FT                   RFNIQNSNFNQYRSFRTFHKSFLYNNFSQRYQSQFGNKMANMNFFRHPNGSSPIKNLNL
FT                   NIRAFMNSKKFDTSDPSTYKQDLVLHSRPQVKSNIRLNVSLTPKFSELTLSMARTVSSA
FT                   GCEETSHNTQTSNGCYVDFPMSSKFSIPAMTILNNEILDELMQDLKILESKIAELKSDL
FT                   QNLFELGELPMKYLHDQNIIRVYFANCDKARLESLLREKNIINGIIYEEAVYGCSSDCA
FT                   NVSEADILSSYYGSSSSLGSSTEYDDDVLSDSSHHPLSNDHIIRPESGNQSQNSQHVSF
FT                   CDEDICWV"
     MRSQTMKNLI SLKKNITRRI KQTLEEIAEN LGHPQQRPVP VPIPIPVRSG RNASRLSKQF        60
     SRYYSTSSNF TGGHYKFRAF QFLNVKYQNG GKLGRIIQNN SNWIRFNIQN SNFNQYRSFR       120
     TFHKSFLYNN FSQRYQSQFG NKMANMNFFR HPNGSSPIKN LNLNIRAFMN SKKFDTSDPS       180
     TYKQDLVLHS RPQVKSNIRL NVSLTPKFSE LTLSMARTVS SAGCEETSHN TQTSNGCYVD       240
     FPMSSKFSIP AMTILNNEIL DELMQDLKIL ESKIAELKSD LQNLFELGEL PMKYLHDQNI       300
     IRVYFANCDK ARLESLLREK NIINGIIYEE AVYGCSSDCA NVSEADILSS YYGSSSSLGS       360
     STEYDDDVLS DSSHHPLSND HIIRPESGNQ SQNSQHVSFC DEDICWV                     407
//

If you have problems or comments...

PBIL Back to PBIL home page