(data stored in ACNUC6288 zone)

EMBL: CR382138.PE146

CR382138.PE146       Location/Qualifiers
FT   CDS             300008..300871
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03410g"
FT                   /old_locus_tag="DEHA0F03784g"
FT                   /old_locus_tag="DEHA-IPF8816"
FT                   /old_locus_tag="DEHA-CDS4389.1"
FT                   /product="DEHA2F03410p"
FT                   /note="some similarities with uniprot|P47977 Saccharomyces
FT                   cerevisiae YLR136C TIS11 mRNA-binding protein expressed
FT                   during iron starvation"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03410g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88827"
FT                   /db_xref="GOA:Q6BMQ7"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMQ7"
FT                   /protein_id="CAG88827.2"
FT                   /translation="MTAYQQVPLQTLPLNDNMMGYRQVNNEQYQKLAGVGGFGSVESTG
FT                   VDVGAVKGDLLADLWSMPSSHECASSTSSTSSSSSPSHNNMWKSPASITPPLMSQGNGN
FT                   YGYLPGGGVGSAMQPNYGMRDSIEYKPLSSNMVFNDLPALTEENLMYGTDSNSFAYIGR
FT                   NSSLSDHSDEIFNFEQQQLHQQQQQQQQQVLLSQQAAQYPSIEQTQQQKNKQLNVNTQL
FT                   YKTELCASYIKMGICPYGNKCQFAHGENELKSVSRPPKWRSKPCANWSKFGSCRYGNRC
FT                   CFKHGE"
     MTAYQQVPLQ TLPLNDNMMG YRQVNNEQYQ KLAGVGGFGS VESTGVDVGA VKGDLLADLW        60
     SMPSSHECAS STSSTSSSSS PSHNNMWKSP ASITPPLMSQ GNGNYGYLPG GGVGSAMQPN       120
     YGMRDSIEYK PLSSNMVFND LPALTEENLM YGTDSNSFAY IGRNSSLSDH SDEIFNFEQQ       180
     QLHQQQQQQQ QQVLLSQQAA QYPSIEQTQQ QKNKQLNVNT QLYKTELCAS YIKMGICPYG       240
     NKCQFAHGEN ELKSVSRPPK WRSKPCANWS KFGSCRYGNR CCFKHGE                     287
//

If you have problems or comments...

PBIL Back to PBIL home page