(data stored in ACNUC6288 zone)

EMBL: CR382138.PE150

CR382138.PE150       Location/Qualifiers
FT   CDS             316263..317672
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03498g"
FT                   /old_locus_tag="DEHA0F03872g"
FT                   /old_locus_tag="DEHA-IPF8801"
FT                   /old_locus_tag="DEHA-CDS2573.1"
FT                   /product="DEHA2F03498p"
FT                   /note="weakly similar to uniprot|Q12468 Saccharomyces
FT                   cerevisiae YDL216C RRI1 subunit of COP9 signalosome (CSN)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03498g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88831"
FT                   /db_xref="GOA:Q6BMQ3"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="InterPro:IPR037740"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMQ3"
FT                   /protein_id="CAG88831.2"
FT                   /translation="MRCIHELADVFINDSDERILTQSLDATEIDKHADYESFFSINSDE
FT                   SIMKARPWKSNAKYFKKTYISSLALCKMSVHAKSGGAIEVMGMMTGKIIKNSIIVMDVY
FT                   PLPVEGTETRVNAQAEGYEYMVQYLENSKQVGRDENIVGWYHSHPGYGCWLSGIDVATQ
FT                   SLNQNFQDPYLAIVIDPMKTEDQGKVEIGAFRTFPDNYKSPDSAAPTNNTRGVPPSKQK
FT                   DFGVHSDKYYSLDIQIFKSNLDTEILNIISNKSWIGKLIKSVNTANHQEQNMIENVFKL
FT                   INKLQKKEVNQLNRFEISFIKKFDLIFEDIISKKLMNDNRFYSTISQSSYDSFSGHGNS
FT                   SSNDEMDDESDLDDRDKSSAPLDISDTGNDDVMSMESSVNVYTDKRGDDNDDDDDNDGY
FT                   DKRPMYTNYRSRANLTKPRKSGSSPEEHVKLSNNVNKTITNISNHSKDIGLTELQDLIA
FT                   LKTKESIFLGK"
     MRCIHELADV FINDSDERIL TQSLDATEID KHADYESFFS INSDESIMKA RPWKSNAKYF        60
     KKTYISSLAL CKMSVHAKSG GAIEVMGMMT GKIIKNSIIV MDVYPLPVEG TETRVNAQAE       120
     GYEYMVQYLE NSKQVGRDEN IVGWYHSHPG YGCWLSGIDV ATQSLNQNFQ DPYLAIVIDP       180
     MKTEDQGKVE IGAFRTFPDN YKSPDSAAPT NNTRGVPPSK QKDFGVHSDK YYSLDIQIFK       240
     SNLDTEILNI ISNKSWIGKL IKSVNTANHQ EQNMIENVFK LINKLQKKEV NQLNRFEISF       300
     IKKFDLIFED IISKKLMNDN RFYSTISQSS YDSFSGHGNS SSNDEMDDES DLDDRDKSSA       360
     PLDISDTGND DVMSMESSVN VYTDKRGDDN DDDDDNDGYD KRPMYTNYRS RANLTKPRKS       420
     GSSPEEHVKL SNNVNKTITN ISNHSKDIGL TELQDLIALK TKESIFLGK                   469
//

If you have problems or comments...

PBIL Back to PBIL home page