(data stored in ACNUC6288 zone)

EMBL: CR382138.PE151

CR382138.PE151       Location/Qualifiers
FT   CDS             318210..320303
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03520g"
FT                   /old_locus_tag="DEHA0F03894g"
FT                   /old_locus_tag="DEHA-IPF8800"
FT                   /old_locus_tag="DEHA-CDS1161.1"
FT                   /product="DEHA2F03520p"
FT                   /note="similar to uniprot|P53874 Saccharomyces cerevisiae
FT                   YNL186W UBP10 Ubiquitin-specific protease that
FT                   deubiquitinates ubiquitin-protein moieties"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03520g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88832"
FT                   /db_xref="GOA:Q6BMQ2"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMQ2"
FT                   /protein_id="CAG88832.2"
FT                   /translation="MSGQANVLSNSVTPLIDRILANPLTFISGKQIESDNFEKPASYIV
FT                   LSKSSKKGDSSESSKASTQEKEPKSPEMRKPRSMAEAVAVYTGKKFLTKAEKKAAKKRK
FT                   VTQPLVDSEEEDVGEVIGGDIKMAESDSDSISDSQYESASEFQSDSNVELPFAEFKSES
FT                   DVKSSSESRSDSELKTESESKSDSESTSESPAGGEEDDEGNDDDDDDDNKDYSLEDNES
FT                   FSESDSGSASDVEDSSNDEEDLEALKHDLKQELQHDPRDISSKDPSLSGSDDDDEEKEE
FT                   ENSDKNTTPPTSPEDEPEKPPATVNASDDLHVLPLNKFYSINEVSSDRGSNNSTRIYKN
FT                   WRELSKRKPVGLLNHGVTCYMNSAIQSLIHIPAVQHYLTDINSGKHNKTLKPRSVSHVL
FT                   AELSKRMWALDDNTSKAKQPKYVNPKRIIQRLDDINCMMSEWQQEDSHEYFMSLMSRLQ
FT                   EDSTPKGVKLNQSIIYDIFGGLLHQSVTCKNCNYVSDTKQEFYDLSLGLNRKKNKDVTE
FT                   NSGPQRYTIEKSIQEFFSSELIKLDRKDKSSGYDCENCKQKSNACKISTIDRSPETLTV
FT                   HLKRFKFNGNSSSKVKQSISYPNYLDLTKFTTLKTPTKYQLVSVIVHEGRSISSGHYIA
FT                   HCLQPDGTWSTYDDEYINKINEKEALSDPSAYVLVYTKLTPRLMKRSNEGNDNLVNAKK
FT                   LKR"
     MSGQANVLSN SVTPLIDRIL ANPLTFISGK QIESDNFEKP ASYIVLSKSS KKGDSSESSK        60
     ASTQEKEPKS PEMRKPRSMA EAVAVYTGKK FLTKAEKKAA KKRKVTQPLV DSEEEDVGEV       120
     IGGDIKMAES DSDSISDSQY ESASEFQSDS NVELPFAEFK SESDVKSSSE SRSDSELKTE       180
     SESKSDSEST SESPAGGEED DEGNDDDDDD DNKDYSLEDN ESFSESDSGS ASDVEDSSND       240
     EEDLEALKHD LKQELQHDPR DISSKDPSLS GSDDDDEEKE EENSDKNTTP PTSPEDEPEK       300
     PPATVNASDD LHVLPLNKFY SINEVSSDRG SNNSTRIYKN WRELSKRKPV GLLNHGVTCY       360
     MNSAIQSLIH IPAVQHYLTD INSGKHNKTL KPRSVSHVLA ELSKRMWALD DNTSKAKQPK       420
     YVNPKRIIQR LDDINCMMSE WQQEDSHEYF MSLMSRLQED STPKGVKLNQ SIIYDIFGGL       480
     LHQSVTCKNC NYVSDTKQEF YDLSLGLNRK KNKDVTENSG PQRYTIEKSI QEFFSSELIK       540
     LDRKDKSSGY DCENCKQKSN ACKISTIDRS PETLTVHLKR FKFNGNSSSK VKQSISYPNY       600
     LDLTKFTTLK TPTKYQLVSV IVHEGRSISS GHYIAHCLQP DGTWSTYDDE YINKINEKEA       660
     LSDPSAYVLV YTKLTPRLMK RSNEGNDNLV NAKKLKR                                697
//

If you have problems or comments...

PBIL Back to PBIL home page