(data stored in ACNUC6288 zone)

EMBL: CR382138.PE152

CR382138.PE152       Location/Qualifiers
FT   CDS             complement(320662..321300)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03542g"
FT                   /old_locus_tag="DEHA0F03916g"
FT                   /old_locus_tag="DEHA-IPF8799"
FT                   /old_locus_tag="DEHA-CDS5236.1"
FT                   /product="DEHA2F03542p"
FT                   /note="weakly similar to uniprot|P38191 Saccharomyces
FT                   cerevisiae YBL049W MOH1 Protein of unknown function has
FT                   homology to kinase Snf7p"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03542g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88833"
FT                   /db_xref="GOA:Q6BMQ1"
FT                   /db_xref="InterPro:IPR004910"
FT                   /db_xref="InterPro:IPR034751"
FT                   /db_xref="InterPro:IPR039058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMQ1"
FT                   /protein_id="CAG88833.2"
FT                   /translation="MGLKYTNFFENSSYESSDTQIVICKNCSSHLCLSNLILSDNFRGS
FT                   TGPAYLVDKLINYQSENGSQETRMLTGNYLINKVKCHQCSNQLGWTYKKAFSYSETYKE
FT                   GKFVIEKDYIKLIPNNFSTASLVEKAKLNNSRRRSSGSSSSSVDYNTTSDDLFKFNSVD
FT                   PTKEKMEESVGDSSINFRDNDGVSILGRLRFQGIDKEEFDEDQDVFVDV"
     MGLKYTNFFE NSSYESSDTQ IVICKNCSSH LCLSNLILSD NFRGSTGPAY LVDKLINYQS        60
     ENGSQETRML TGNYLINKVK CHQCSNQLGW TYKKAFSYSE TYKEGKFVIE KDYIKLIPNN       120
     FSTASLVEKA KLNNSRRRSS GSSSSSVDYN TTSDDLFKFN SVDPTKEKME ESVGDSSINF       180
     RDNDGVSILG RLRFQGIDKE EFDEDQDVFV DV                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page