(data stored in ACNUC6288 zone)

EMBL: CR382138.PE157

CR382138.PE157       Location/Qualifiers
FT   CDS             327236..327769
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03652g"
FT                   /old_locus_tag="DEHA0F04048g"
FT                   /old_locus_tag="DEHA-IPF8793"
FT                   /old_locus_tag="DEHA-CDS5646.1"
FT                   /product="DEHA2F03652p"
FT                   /note="some similarities with uniprot|Q871R2 Neurospora
FT                   crassa 7F4 Hypothetical protein 7F4.280"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03652g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88839"
FT                   /db_xref="GOA:Q6BMP6"
FT                   /db_xref="InterPro:IPR013957"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMP6"
FT                   /protein_id="CAG88839.2"
FT                   /translation="MVLSNKNKIKINLKQTPKFDASRSRSRSPHISSESLTSNSQGSDQ
FT                   KDQNYRDRSQERSIDKMQKSDLYKKDNTSLQDLPLSNSSFNNKIKLPEHKQEQDSRGRQ
FT                   RERNDEDHINMESPVEAQDDDMISLMGFGGFGTTKGKHVKGTKGGNTKKEAKSEYRTYM
FT                   NRSKGFNRPLSPTR"
     MVLSNKNKIK INLKQTPKFD ASRSRSRSPH ISSESLTSNS QGSDQKDQNY RDRSQERSID        60
     KMQKSDLYKK DNTSLQDLPL SNSSFNNKIK LPEHKQEQDS RGRQRERNDE DHINMESPVE       120
     AQDDDMISLM GFGGFGTTKG KHVKGTKGGN TKKEAKSEYR TYMNRSKGFN RPLSPTR          177
//

If you have problems or comments...

PBIL Back to PBIL home page