(data stored in ACNUC6288 zone)

EMBL: CR382138.PE161

CR382138.PE161       Location/Qualifiers
FT   CDS             complement(334136..334567)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03740g"
FT                   /old_locus_tag="DEHA0F04136g"
FT                   /old_locus_tag="DEHA-IPF8786"
FT                   /old_locus_tag="DEHA-CDS6233.1"
FT                   /product="DEHA2F03740p"
FT                   /note="highly similar to uniprot|P53875 Saccharomyces
FT                   cerevisiae YNL185c MRPL19 ribosomal protein of the large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03740g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88843"
FT                   /db_xref="GOA:Q6BMP2"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMP2"
FT                   /protein_id="CAG88843.2"
FT                   /translation="MSAKNVMVKLIVGAGQAAPAPPVGPALGSKGVKAIDFCKEFNART
FT                   GNYQPGIPIPCLLTIKPDRSFTFEMKSPPTSWLLLKAAQAKKGSDKPTHNIVGEVSLKH
FT                   VYEIAKIKKTDDRHKEVDLQAICGAVISTAEAVGVKIVP"
     MSAKNVMVKL IVGAGQAAPA PPVGPALGSK GVKAIDFCKE FNARTGNYQP GIPIPCLLTI        60
     KPDRSFTFEM KSPPTSWLLL KAAQAKKGSD KPTHNIVGEV SLKHVYEIAK IKKTDDRHKE       120
     VDLQAICGAV ISTAEAVGVK IVP                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page