(data stored in ACNUC6288 zone)

EMBL: CR382138.PE164

CR382138.PE164       Location/Qualifiers
FT   CDS             complement(338944..342051)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03806g"
FT                   /old_locus_tag="DEHA0F04202g"
FT                   /old_locus_tag="DEHA-IPF8779"
FT                   /old_locus_tag="DEHA-CDS0399.1"
FT                   /product="DEHA2F03806p"
FT                   /note="similar to uniprot|P49095 Saccharomyces cerevisiae
FT                   YMR189W GCV2 P subunit of the mitochondrial glycine
FT                   decarboxylase complex required for the catabolism of
FT                   glycine to 5 10-methylene-THF"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03806g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88846"
FT                   /db_xref="GOA:Q6BMN9"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMN9"
FT                   /protein_id="CAG88846.2"
FT                   /translation="MISRVVARSARANRLSTLTRSVPRAYNLNLKLAASNRFLASKADT
FT                   SSADYEKVYDPSAKTVSLGNLDTFARRHLGPTPENVKTMLSALGYKDLDEFLSKAIPEH
FT                   VLYKRALQIQPQQGFTESEMLEHLHNLANKNKIVKSFIGKGYAGTKVPPVIQRNLLESP
FT                   EWYTSYTPYQPEISQGRLESLLNYQTMVTSLTGLNMANASLLDEGTAAGEAMSLSFHSL
FT                   KGKRGKYAVDTNLHPQTLDVMKSRAENIGVEIVELPLSTQEGLEELERIASDSCGALVQ
FT                   YPGTDGSLNNYTKVGEIVHAHKGLFAMATDLLALTLIKSPAEFNADIALGTSQRFGVPF
FT                   GYGGPHAAFFATNMKYSRKIPGRIVGLSKDRLGKPALRLALQTREQHIKREKATSNICT
FT                   AQALLANMAAMYAVYHGPKGLKDIASRVYGYTTVLANEISNNSQHEIVNDKWFDTLTVK
FT                   LGGGVKSDEILNKALNEYNINLFKAGEDKVSLCLDETVEEKDLIALVDVFTGNDSFSTS
FT                   SISELPKLPTELLRTDEILAHPVFNTHRSETSMLRYLHLLQSRDLSLANSMIPLGSCTM
FT                   KLNATVEMQTLSMPGFNQIHPFAPLNQAQGYKELVDEFEKDLNDITGFDATTNMPNSGA
FT                   QGEYTGLSLIRQYHKSKGEYEQRNICLIPVSAHGTNPASAAMCGLKVVPVKCLNNGSID
FT                   VDDLKVKAEKHAENLCSIMITYPSTYGLFEPGIKTAIDLVHNNGGLVYLDGANMNAQVG
FT                   LTSPGDLGADVCHLNIHKTFALSHGGGGPGQAPVCVKEHLKPFLPKHHFLDTPHSTNES
FT                   IQAVNSAPYGSASVIPVSYSYIKMLGAKALPHVSSIAMLNANYMLEKLKDDYQIMFVDH
FT                   SASTDEGLKHCAHEFILDLREFKAVGVEAIDVAKRLQDYGFHAPTMSFPVAGTLMIEPT
FT                   ESENLEELDRFINSLLSIRKEINAMANKEPLGQVLKNAPHSLNDIVSTSQADWEARGYT
FT                   REQAAYPLPFLKESKCWPSVSRVDDTYGDMNLMCTCPSVEEVAADQ"
     MISRVVARSA RANRLSTLTR SVPRAYNLNL KLAASNRFLA SKADTSSADY EKVYDPSAKT        60
     VSLGNLDTFA RRHLGPTPEN VKTMLSALGY KDLDEFLSKA IPEHVLYKRA LQIQPQQGFT       120
     ESEMLEHLHN LANKNKIVKS FIGKGYAGTK VPPVIQRNLL ESPEWYTSYT PYQPEISQGR       180
     LESLLNYQTM VTSLTGLNMA NASLLDEGTA AGEAMSLSFH SLKGKRGKYA VDTNLHPQTL       240
     DVMKSRAENI GVEIVELPLS TQEGLEELER IASDSCGALV QYPGTDGSLN NYTKVGEIVH       300
     AHKGLFAMAT DLLALTLIKS PAEFNADIAL GTSQRFGVPF GYGGPHAAFF ATNMKYSRKI       360
     PGRIVGLSKD RLGKPALRLA LQTREQHIKR EKATSNICTA QALLANMAAM YAVYHGPKGL       420
     KDIASRVYGY TTVLANEISN NSQHEIVNDK WFDTLTVKLG GGVKSDEILN KALNEYNINL       480
     FKAGEDKVSL CLDETVEEKD LIALVDVFTG NDSFSTSSIS ELPKLPTELL RTDEILAHPV       540
     FNTHRSETSM LRYLHLLQSR DLSLANSMIP LGSCTMKLNA TVEMQTLSMP GFNQIHPFAP       600
     LNQAQGYKEL VDEFEKDLND ITGFDATTNM PNSGAQGEYT GLSLIRQYHK SKGEYEQRNI       660
     CLIPVSAHGT NPASAAMCGL KVVPVKCLNN GSIDVDDLKV KAEKHAENLC SIMITYPSTY       720
     GLFEPGIKTA IDLVHNNGGL VYLDGANMNA QVGLTSPGDL GADVCHLNIH KTFALSHGGG       780
     GPGQAPVCVK EHLKPFLPKH HFLDTPHSTN ESIQAVNSAP YGSASVIPVS YSYIKMLGAK       840
     ALPHVSSIAM LNANYMLEKL KDDYQIMFVD HSASTDEGLK HCAHEFILDL REFKAVGVEA       900
     IDVAKRLQDY GFHAPTMSFP VAGTLMIEPT ESENLEELDR FINSLLSIRK EINAMANKEP       960
     LGQVLKNAPH SLNDIVSTSQ ADWEARGYTR EQAAYPLPFL KESKCWPSVS RVDDTYGDMN      1020
     LMCTCPSVEE VAADQ                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page