(data stored in ACNUC6288 zone)

EMBL: CR382138.PE173

CR382138.PE173       Location/Qualifiers
FT   CDS             complement(359634..361454)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04004g"
FT                   /old_locus_tag="DEHA0F04422g"
FT                   /old_locus_tag="DEHA-IPF8760"
FT                   /old_locus_tag="DEHA-CDS1599.1"
FT                   /product="DEHA2F04004p"
FT                   /note="weakly similar to uniprot|Q12514 Saccharomyces
FT                   cerevisiae YPR072W NOT5 Subunit of the CCR4-NOT complex
FT                   which is a global transcriptional regulator with roles in
FT                   transcription initiation and elongation and in mRNA
FT                   degradation and similar to CA3926|IPF16198 Candida albicans
FT                   IPF16198"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04004g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88856"
FT                   /db_xref="GOA:Q6BMN1"
FT                   /db_xref="InterPro:IPR007207"
FT                   /db_xref="InterPro:IPR007282"
FT                   /db_xref="InterPro:IPR012270"
FT                   /db_xref="InterPro:IPR038635"
FT                   /db_xref="InterPro:IPR040168"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMN1"
FT                   /protein_id="CAG88856.2"
FT                   /translation="MSTRKLQQEFDKTNKKIAEGLTVFDDIYDKLMTTEISSQKEKLES
FT                   DLKKEIKKLQRSRDQLKTWISDTSIKLDKSLIQDNRTKIEHAMDQFKDLEKSSKIKQFS
FT                   NEGLELQSQKTKYNKFTDPEDAKKQEACNYIGDIIDQLNQQNESLESEIHSLATQLKKT
FT                   KSANSYSVQSSIDDCKYNVERNNNHLSKLEMILRNIENENLDPERVDDIKDDLEYYVET
FT                   NQEDDYVEYDDFYDQLEMSEENDILGSGQDANEDNEENKAEVKEGPKEEPKDGPKEEPK
FT                   PETKTETKPEAKTESKRETKPEIKSEAKSEPKSSNESTSAASTLARKGKTTVVPAANPP
FT                   PLNTAQSYSNIIKASMSSPAAAKVLPPGLNQAKSSTSSPQRTPQKLHQADDSKKRVVSQ
FT                   TQHIPSTQPETRSETQSPILNVNKPIFDTVNRLSTLPQSRLHNPLPFQSIVSLLESSLL
FT                   NCPDSFDAEKPRQYHPTSIHPSSVDYPQEPMYELNSSHIMKKFDNDTLFFCFYYSEGID
FT                   NLAKWNAAQELSKRGWIFNTDVKQWFLKDNKNGGKNRSMSIIQKEEDEQNKQDDSANNE
FT                   ENYKYFDYEKTWLTRRKENYKFSQDFRESF"
     MSTRKLQQEF DKTNKKIAEG LTVFDDIYDK LMTTEISSQK EKLESDLKKE IKKLQRSRDQ        60
     LKTWISDTSI KLDKSLIQDN RTKIEHAMDQ FKDLEKSSKI KQFSNEGLEL QSQKTKYNKF       120
     TDPEDAKKQE ACNYIGDIID QLNQQNESLE SEIHSLATQL KKTKSANSYS VQSSIDDCKY       180
     NVERNNNHLS KLEMILRNIE NENLDPERVD DIKDDLEYYV ETNQEDDYVE YDDFYDQLEM       240
     SEENDILGSG QDANEDNEEN KAEVKEGPKE EPKDGPKEEP KPETKTETKP EAKTESKRET       300
     KPEIKSEAKS EPKSSNESTS AASTLARKGK TTVVPAANPP PLNTAQSYSN IIKASMSSPA       360
     AAKVLPPGLN QAKSSTSSPQ RTPQKLHQAD DSKKRVVSQT QHIPSTQPET RSETQSPILN       420
     VNKPIFDTVN RLSTLPQSRL HNPLPFQSIV SLLESSLLNC PDSFDAEKPR QYHPTSIHPS       480
     SVDYPQEPMY ELNSSHIMKK FDNDTLFFCF YYSEGIDNLA KWNAAQELSK RGWIFNTDVK       540
     QWFLKDNKNG GKNRSMSIIQ KEEDEQNKQD DSANNEENYK YFDYEKTWLT RRKENYKFSQ       600
     DFRESF                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page