(data stored in ACNUC6288 zone)

EMBL: CR382138.PE174

CR382138.PE174       Location/Qualifiers
FT   CDS             complement(join(361642..362080,362140..362204))
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04026g"
FT                   /product="DEHA2F04026p"
FT                   /note="similar to uniprot|P40347 Saccharomyces cerevisiae
FT                   YPR073C LTP1 Protein phosphotyrosine phosphatase of unknown
FT                   cellular role"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04026g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66265"
FT                   /db_xref="GOA:B5RU72"
FT                   /db_xref="InterPro:IPR002115"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:B5RU72"
FT                   /protein_id="CAR66265.1"
FT                   /translation="MTATSRTVDKKISVAFVCLGNICRSPMAEAIFKHKVHELGYSEYF
FT                   KIIDSYGTGGYHIGDPPDSRSAKTCRKHGVPVDHSAQQITSKDFKKFDYVICMDQSNLS
FT                   DLLFMKPRESKARVALFGEWKADSKFNTVVQDPYYGGINGFETNFQQISHFSEEFLKRE
FT                   VGEL"
     MTATSRTVDK KISVAFVCLG NICRSPMAEA IFKHKVHELG YSEYFKIIDS YGTGGYHIGD        60
     PPDSRSAKTC RKHGVPVDHS AQQITSKDFK KFDYVICMDQ SNLSDLLFMK PRESKARVAL       120
     FGEWKADSKF NTVVQDPYYG GINGFETNFQ QISHFSEEFL KREVGEL                     167
//

If you have problems or comments...

PBIL Back to PBIL home page