(data stored in ACNUC6288 zone)

EMBL: CR382138.PE195

CR382138.PE195       Location/Qualifiers
FT   CDS             408615..409439
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04488g"
FT                   /old_locus_tag="DEHA0F04917g"
FT                   /old_locus_tag="DEHA-IPF8711"
FT                   /old_locus_tag="DEHA-CDS4530.1"
FT                   /product="DEHA2F04488p"
FT                   /note="some similarities with uniprot|P28817 Saccharomyces
FT                   cerevisiae YDR036C EHD3 Protein of unconfirmed function
FT                   plays an indirect role in endocytic membrane trafficking
FT                   member of a family of enoyl-CoA hydratase/isomerases and
FT                   similar to CA5879|IPF12076 Candida albicans IPF12076"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04488g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88879"
FT                   /db_xref="GOA:Q6BML0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BML0"
FT                   /protein_id="CAG88879.2"
FT                   /translation="MSEFNLEDYKKYDKFIVSEVEEGFYHVQFNNPKSLNAFTEQVWRD
FT                   YAEILERLDKCEETSVILISSAIPKAFSSGLDLKDAIKTMSSTVSNSEKERYDSLHQHI
FT                   VDFQYCIAAPARIRTPTICLMNGINYGLALDISSACSIRVATADCKFSIREIKIGIPAD
FT                   IGSLQRMPTIVNNKSLMYQYALTGGVFGADEATKLGFVSAVLPDLNAGVEYCKNLGENI
FT                   NQHQQWAIKGTKESIQSIVDNGSPSEGLKNIAHYNATHIDGRFVRAMSGIKL"
     MSEFNLEDYK KYDKFIVSEV EEGFYHVQFN NPKSLNAFTE QVWRDYAEIL ERLDKCEETS        60
     VILISSAIPK AFSSGLDLKD AIKTMSSTVS NSEKERYDSL HQHIVDFQYC IAAPARIRTP       120
     TICLMNGINY GLALDISSAC SIRVATADCK FSIREIKIGI PADIGSLQRM PTIVNNKSLM       180
     YQYALTGGVF GADEATKLGF VSAVLPDLNA GVEYCKNLGE NINQHQQWAI KGTKESIQSI       240
     VDNGSPSEGL KNIAHYNATH IDGRFVRAMS GIKL                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page