(data stored in ACNUC6288 zone)

EMBL: CR382138.PE202

CR382138.PE202       Location/Qualifiers
FT   CDS             418701..420782
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04642g"
FT                   /old_locus_tag="IPF_8700"
FT                   /product="DEHA2F04642p"
FT                   /note="some similarities with uniprot|Q874R3
FT                   Schizosaccharomyces pombe apc2 Apc2 protein and similar to
FT                   CA5887|IPF2415 Candida albicans IPF2415"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04642g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66273"
FT                   /db_xref="GOA:B5RU95"
FT                   /db_xref="InterPro:IPR001373"
FT                   /db_xref="InterPro:IPR016158"
FT                   /db_xref="InterPro:IPR036317"
FT                   /db_xref="UniProtKB/TrEMBL:B5RU95"
FT                   /protein_id="CAR66273.1"
FT                   /translation="MITIPLSKENFNQVIPIPTLQDLAANSSNSDQQSNNIENDIDYLL
FT                   HWLSPFWPDNRVFNEPSQRVKSAVRSCLRDESSQLDFVKLYGNSIKPRFFEELSPVLLD
FT                   DRVLLTEAIDKIKFIKDYYNQYIKYLNLNKLPYDILNRNLNSLFHSILVENKQSKFIKN
FT                   LTNYLYEMLFGDEKCLHGSVHGYISVLLSIELIDELNSIIIRLSIKQIKDYILATCTKV
FT                   WDKPLLEEINCWIKSDLFPSFNLIMRLSNFDFSEKYLYDLIKIAHDELVSLRIKEIFGL
FT                   VVDYPNSYIALSELHQCLSFKFNSHNTGTNISNLSTVINSNINTSEIDSANSLITISNF
FT                   SSILINNSANSQAYQRAKLVDTFIQLCHEELLHSGANTVNVITCYTSTIKSFLIIDPKG
FT                   VLLDRVVRPIRRYLKTREDIIIKLVHGLLDQSESNDLLELAQELRNGTKKTVIADDLMD
FT                   LTWVPDPIDALPDFKKSKMTDIIESLISIFDSKEIFINEFTQLFGERLINLHDYDVKDV
FT                   TDHLDLLKLRFGENEFTTLDIMIKDIEQSKITNEKINYRNEYSFHSTILSHLYWPTVCE
FT                   NVSHNDSFKLPDTISNQFEKFDKEFAGVKKGRGLKLLPSLGLVRLELSIRNTKLSFEVT
FT                   PDKASIISLFHDKVDELRLTNIASQLDMQPYVASKAIDYWIKQNVLTETSKGIYKVNE"
     MITIPLSKEN FNQVIPIPTL QDLAANSSNS DQQSNNIEND IDYLLHWLSP FWPDNRVFNE        60
     PSQRVKSAVR SCLRDESSQL DFVKLYGNSI KPRFFEELSP VLLDDRVLLT EAIDKIKFIK       120
     DYYNQYIKYL NLNKLPYDIL NRNLNSLFHS ILVENKQSKF IKNLTNYLYE MLFGDEKCLH       180
     GSVHGYISVL LSIELIDELN SIIIRLSIKQ IKDYILATCT KVWDKPLLEE INCWIKSDLF       240
     PSFNLIMRLS NFDFSEKYLY DLIKIAHDEL VSLRIKEIFG LVVDYPNSYI ALSELHQCLS       300
     FKFNSHNTGT NISNLSTVIN SNINTSEIDS ANSLITISNF SSILINNSAN SQAYQRAKLV       360
     DTFIQLCHEE LLHSGANTVN VITCYTSTIK SFLIIDPKGV LLDRVVRPIR RYLKTREDII       420
     IKLVHGLLDQ SESNDLLELA QELRNGTKKT VIADDLMDLT WVPDPIDALP DFKKSKMTDI       480
     IESLISIFDS KEIFINEFTQ LFGERLINLH DYDVKDVTDH LDLLKLRFGE NEFTTLDIMI       540
     KDIEQSKITN EKINYRNEYS FHSTILSHLY WPTVCENVSH NDSFKLPDTI SNQFEKFDKE       600
     FAGVKKGRGL KLLPSLGLVR LELSIRNTKL SFEVTPDKAS IISLFHDKVD ELRLTNIASQ       660
     LDMQPYVASK AIDYWIKQNV LTETSKGIYK VNE                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page