(data stored in ACNUC6288 zone)

EMBL: CR382138.PE215

CR382138.PE215       Location/Qualifiers
FT   CDS             join(447286..447307,447425..451713)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04972g"
FT                   /product="DEHA2F04972p"
FT                   /note="similar to uniprot|P47169 Saccharomyces cerevisiae
FT                   YJR137C ECM17 Sulfite reductase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04972g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66276"
FT                   /db_xref="GOA:B5RU98"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011786"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:B5RU98"
FT                   /protein_id="CAR66276.1"
FT                   /translation="MGSQIEAISNIVKNIEGSVFVTQPAKSVESSFSKYLPNANTLIDS
FT                   NDPYSVINNYAEHRTEGEEQDDEIITVITNGSTIFRNLPFLSSTAFKTSKIVSHVELVN
FT                   FDFSIVSTLRDLNVPVLVSQSTNESVVFSKLSYNLSQRFGQPVFHFFAPSNYRSALSEK
FT                   VDGKIIIDDLSKYEFNDLLSKFGVSPFEVVTGSSKAQHSIVYFGQLNDELISAAKNENV
FT                   VLVSIKVYKPFDLQKLLTIIPSSVETITFVSQTTSPSTSFAPLLLDFFQEYSKYQTLKN
FT                   FTKVAAAFFGYIKSEKYSEIIGNLLSNIKSESPVQNLSFGKTNTELATKASKERHGESL
FT                   KAITNVHNLEQAYLKILQQVNTDSLNILNEFNADNIGVETNPEYGYGAYLNFEEQQKQL
FT                   TDLVYAAIQDNLFKSIDNEKLIDNLSKWLINVRENIETTSNSVLETIKLLETDTNSSNA
FT                   AKILDLKEYFKVNKNWLIGSDAWSYDLGSSGVHNLITSNKNINMLIIDSEPYEDKSNDK
FT                   TVNGFRKKDVGLYAMNYGGCYVASVAIYSSYTQVLQAFIEAEKFNGPAIVLAYLPYHNE
FT                   FDNTLSILKETKLAVDSGYWPLYRYDPTIEDESKSFILDSSNLRNQLKNFLDRENKLTL
FT                   LAKKDPLLSRNLTSNATTEIKAKQLQAANDSYSKLLQGLSGPPLTVAFASDGGNAEAVA
FT                   KKINRQALGRGLKSIVLAMDDISMEDLPNETNIVFIASTSGQGEFPTNGKQFWDGLKNS
FT                   NDIDLSTIKFSVFGLGDSEYWPRKEDKHYYNKPSKDLFNKLKFYGGVELIDIGLGDDQD
FT                   ADGFNTGLNEWEPKLWKALGVDNVEGVEEPKPLTNEDMKIQSDYLRGTIVEGLNDQSTG
FT                   AISAVDQQLTKFHGIYMQDDRDIRDDRKSKGMEPAYAFMVRVRLPGGIATPSQYLRMDE
FT                   LSNERGNGTLKLTTRATFQLHGVVKHDLKPAIRGMNAALMDTLAACGDVNRNVMVSALP
FT                   HNAKVHSQISKTGALISEYLLPQTTAYHEIWLQGEDEGDKAGASKNWENRKEGPKKEKT
FT                   LVAGNALTDFEPMYGPTYLPRKFKVVITVPPYNDVDVYAHDIGLIAIVEGDEVIGYNVL
FT                   AGGGMGSTHNNKKTYPRTGSMFGYIAKDQIHIACEKIMLVQRDFGDRTNRKHARLKYTI
FT                   DDLGVEVFKGKVEELLGFKFEKAKPFEIKSNVDYFGWCKDETGANHFTAFIENGRIEDT
FT                   PELPQKTGLSKIAEYLLQNERPGEFRLTGNQHILISNINDDDLDTVKSLLAQYKLDNTD
FT                   FSGLRLSSAACVAFPTCGLAMAESERYLPELITKLEEALEDYGLRHDSVVMRMTGCPNG
FT                   CARPWVAEVALVGKAFGAYNLMLGGGHHGERLNKIYRYSIKEDEILSILKPLFKRWSLE
FT                   RNEGEPFGDFCIRIGIIKPTTEGKFFHDDLPEDA"
     MGSQIEAISN IVKNIEGSVF VTQPAKSVES SFSKYLPNAN TLIDSNDPYS VINNYAEHRT        60
     EGEEQDDEII TVITNGSTIF RNLPFLSSTA FKTSKIVSHV ELVNFDFSIV STLRDLNVPV       120
     LVSQSTNESV VFSKLSYNLS QRFGQPVFHF FAPSNYRSAL SEKVDGKIII DDLSKYEFND       180
     LLSKFGVSPF EVVTGSSKAQ HSIVYFGQLN DELISAAKNE NVVLVSIKVY KPFDLQKLLT       240
     IIPSSVETIT FVSQTTSPST SFAPLLLDFF QEYSKYQTLK NFTKVAAAFF GYIKSEKYSE       300
     IIGNLLSNIK SESPVQNLSF GKTNTELATK ASKERHGESL KAITNVHNLE QAYLKILQQV       360
     NTDSLNILNE FNADNIGVET NPEYGYGAYL NFEEQQKQLT DLVYAAIQDN LFKSIDNEKL       420
     IDNLSKWLIN VRENIETTSN SVLETIKLLE TDTNSSNAAK ILDLKEYFKV NKNWLIGSDA       480
     WSYDLGSSGV HNLITSNKNI NMLIIDSEPY EDKSNDKTVN GFRKKDVGLY AMNYGGCYVA       540
     SVAIYSSYTQ VLQAFIEAEK FNGPAIVLAY LPYHNEFDNT LSILKETKLA VDSGYWPLYR       600
     YDPTIEDESK SFILDSSNLR NQLKNFLDRE NKLTLLAKKD PLLSRNLTSN ATTEIKAKQL       660
     QAANDSYSKL LQGLSGPPLT VAFASDGGNA EAVAKKINRQ ALGRGLKSIV LAMDDISMED       720
     LPNETNIVFI ASTSGQGEFP TNGKQFWDGL KNSNDIDLST IKFSVFGLGD SEYWPRKEDK       780
     HYYNKPSKDL FNKLKFYGGV ELIDIGLGDD QDADGFNTGL NEWEPKLWKA LGVDNVEGVE       840
     EPKPLTNEDM KIQSDYLRGT IVEGLNDQST GAISAVDQQL TKFHGIYMQD DRDIRDDRKS       900
     KGMEPAYAFM VRVRLPGGIA TPSQYLRMDE LSNERGNGTL KLTTRATFQL HGVVKHDLKP       960
     AIRGMNAALM DTLAACGDVN RNVMVSALPH NAKVHSQISK TGALISEYLL PQTTAYHEIW      1020
     LQGEDEGDKA GASKNWENRK EGPKKEKTLV AGNALTDFEP MYGPTYLPRK FKVVITVPPY      1080
     NDVDVYAHDI GLIAIVEGDE VIGYNVLAGG GMGSTHNNKK TYPRTGSMFG YIAKDQIHIA      1140
     CEKIMLVQRD FGDRTNRKHA RLKYTIDDLG VEVFKGKVEE LLGFKFEKAK PFEIKSNVDY      1200
     FGWCKDETGA NHFTAFIENG RIEDTPELPQ KTGLSKIAEY LLQNERPGEF RLTGNQHILI      1260
     SNINDDDLDT VKSLLAQYKL DNTDFSGLRL SSAACVAFPT CGLAMAESER YLPELITKLE      1320
     EALEDYGLRH DSVVMRMTGC PNGCARPWVA EVALVGKAFG AYNLMLGGGH HGERLNKIYR      1380
     YSIKEDEILS ILKPLFKRWS LERNEGEPFG DFCIRIGIIK PTTEGKFFHD DLPEDA          1436
//

If you have problems or comments...

PBIL Back to PBIL home page