(data stored in ACNUC6288 zone)

EMBL: CR382138.PE229

CR382138.PE229       Location/Qualifiers
FT   CDS             complement(476052..478979)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05302g"
FT                   /old_locus_tag="IPF_8655"
FT                   /product="DEHA2F05302p"
FT                   /note="weakly similar to uniprot|P14736 Saccharomyces
FT                   cerevisiae YER162C RAD4 Protein that recognizes and binds
FT                   damaged DNA (with Rad23p) during nucleotide excision
FT                   repair"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05302g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66280"
FT                   /db_xref="GOA:B5RUA2"
FT                   /db_xref="InterPro:IPR004583"
FT                   /db_xref="InterPro:IPR018325"
FT                   /db_xref="InterPro:IPR018326"
FT                   /db_xref="InterPro:IPR018327"
FT                   /db_xref="InterPro:IPR018328"
FT                   /db_xref="InterPro:IPR036985"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR042488"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUA2"
FT                   /protein_id="CAR66280.1"
FT                   /translation="MSEYRYKELLKESLKGSEVDNGTNTRKRRKTGGQYVFNGLDNTKI
FT                   ENQEVITISDNDQESEDSVNSSDFEDVSLDDEEESHGLNLFPDNTDSNDKQESLSITIN
FT                   PVQEEVKKKRKFNSISKSEREQRRIIHQMYVGLMLTHGVIRNRWCNDYNLLMELKKNVS
FT                   PQILELLHQKDSDDVLPLVKSRRFLDGLKKLMMMYSLNYRVTSQGLVRKNWNELSIKQS
FT                   KIEANVTFSKFFNLVTKFRGSRDIAAQGFVSLLRSVDLNARLVFSLQPPDYTSITELPK
FT                   INNNNQTTSSPEVTQSPLLQRFASRNSKRNLLDSMRKKSTTVTDEVKHANYFEDSSYPI
FT                   FWVEVWDKYVKKWVSIDPIVLQTIEVPPMRRKCKFEPPSTDIRNQLTYVIAYDRLGGVK
FT                   DVTRRYSLYYNAKTVKKKIHFRSEEDEIWYNRILKASCSQLRRNKINKIDILESKEFHT
FT                   RDLAEGVPNNIADFKNHPVYALESQLKQNEIIFPKDESSTCGFFRNKSSKKSQEKAVIP
FT                   IYKRSHVHGLRSAKAWYLRGRVLKVGVQPLKLKKKQMHQKQPTSDDDEEEETTRLYAEF
FT                   QTKLYIPPPIVHGEIPKNAYGNIDIYTPSMLPDNGYLVDTTSQFSMKIAERAAKIIDVD
FT                   YAKAIVAFDFGKSGKKKSQSRNPTAREGGILIDIQYKEAVYLVMNTLLEEEESLKRRVV
FT                   ELNSLNNWKYFLTKLRISERLNKVHGKLNSEDEESNFTDESEDDDFSIHSDNSGSDTKE
FT                   FGGGGFFISGNPESNSATEKYEATPEGFEEPYIGKSEGNEGVMEAKYMVEDTDFIEEES
FT                   GGGFFVEDPEPEAKYSQARIGGPSINVELDDMPDYYFKQDENGELIYDPSSDGNQLRSE
FT                   SSGADGTDTPKGNHDLSCTYLSKEALPDRVLTQDDTHEETSQMILSPEAANDIEATGKT
FT                   IVDKNDSSVSSCGKSSSGVESFQDSLGEEIAKEEQVFGFEYSDTD"
     MSEYRYKELL KESLKGSEVD NGTNTRKRRK TGGQYVFNGL DNTKIENQEV ITISDNDQES        60
     EDSVNSSDFE DVSLDDEEES HGLNLFPDNT DSNDKQESLS ITINPVQEEV KKKRKFNSIS       120
     KSEREQRRII HQMYVGLMLT HGVIRNRWCN DYNLLMELKK NVSPQILELL HQKDSDDVLP       180
     LVKSRRFLDG LKKLMMMYSL NYRVTSQGLV RKNWNELSIK QSKIEANVTF SKFFNLVTKF       240
     RGSRDIAAQG FVSLLRSVDL NARLVFSLQP PDYTSITELP KINNNNQTTS SPEVTQSPLL       300
     QRFASRNSKR NLLDSMRKKS TTVTDEVKHA NYFEDSSYPI FWVEVWDKYV KKWVSIDPIV       360
     LQTIEVPPMR RKCKFEPPST DIRNQLTYVI AYDRLGGVKD VTRRYSLYYN AKTVKKKIHF       420
     RSEEDEIWYN RILKASCSQL RRNKINKIDI LESKEFHTRD LAEGVPNNIA DFKNHPVYAL       480
     ESQLKQNEII FPKDESSTCG FFRNKSSKKS QEKAVIPIYK RSHVHGLRSA KAWYLRGRVL       540
     KVGVQPLKLK KKQMHQKQPT SDDDEEEETT RLYAEFQTKL YIPPPIVHGE IPKNAYGNID       600
     IYTPSMLPDN GYLVDTTSQF SMKIAERAAK IIDVDYAKAI VAFDFGKSGK KKSQSRNPTA       660
     REGGILIDIQ YKEAVYLVMN TLLEEEESLK RRVVELNSLN NWKYFLTKLR ISERLNKVHG       720
     KLNSEDEESN FTDESEDDDF SIHSDNSGSD TKEFGGGGFF ISGNPESNSA TEKYEATPEG       780
     FEEPYIGKSE GNEGVMEAKY MVEDTDFIEE ESGGGFFVED PEPEAKYSQA RIGGPSINVE       840
     LDDMPDYYFK QDENGELIYD PSSDGNQLRS ESSGADGTDT PKGNHDLSCT YLSKEALPDR       900
     VLTQDDTHEE TSQMILSPEA ANDIEATGKT IVDKNDSSVS SCGKSSSGVE SFQDSLGEEI       960
     AKEEQVFGFE YSDTD                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page