(data stored in ACNUC6288 zone)

EMBL: CR382138.PE232

CR382138.PE232       Location/Qualifiers
FT   CDS             483586..484647
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05368g"
FT                   /old_locus_tag="DEHA0F05874g"
FT                   /old_locus_tag="DEHA-IPF8649"
FT                   /old_locus_tag="DEHA-CDS3640.1"
FT                   /product="DEHA2F05368p"
FT                   /note="weakly similar to uniprot|P06843 Saccharomyces
FT                   cerevisiae YER161C SPT2 Protein involved in negative
FT                   regulation of transcription exhibits regulated interactions
FT                   with both histones and SWI-SNF components has similarity to
FT                   mammalian HMG1 proteins and similar to CA4352|IPF3642
FT                   Candida albicans IPF3642 Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05368g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88920"
FT                   /db_xref="InterPro:IPR013256"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMH6"
FT                   /protein_id="CAG88920.2"
FT                   /translation="MSLSNILQHVKRKGQIIPKTNQSGRDGTPETNRSTEESNNKNQYR
FT                   YSNGETRTVDPVVARLKAARKLERERKEQEAREKKGLAPKKPKSVPRTNTNSSRNNEVK
FT                   NNNGVGRMNNSSIRSGANMCPNVPPSHKPVKKMNFNDLMKKASKIDQSKLSVSIKPKAK
FT                   SPEVRPTTSKHKPSSRASSAPTEGYRNVPKRKEGRPTTSKYSNSDDNKPSARAPLPVRK
FT                   PSTKLEEKLKSSGKTKPSDTRSNRSRSYNDSEDEYSESFIVSDEEEADYGNSNVPDYDR
FT                   DEIWAIFNRGKKRSYYDRYDNDDSGDDMEATGAEIWEEERRSKRNAELEDRKELEEEQR
FT                   LAALKKARKMKQR"
     MSLSNILQHV KRKGQIIPKT NQSGRDGTPE TNRSTEESNN KNQYRYSNGE TRTVDPVVAR        60
     LKAARKLERE RKEQEAREKK GLAPKKPKSV PRTNTNSSRN NEVKNNNGVG RMNNSSIRSG       120
     ANMCPNVPPS HKPVKKMNFN DLMKKASKID QSKLSVSIKP KAKSPEVRPT TSKHKPSSRA       180
     SSAPTEGYRN VPKRKEGRPT TSKYSNSDDN KPSARAPLPV RKPSTKLEEK LKSSGKTKPS       240
     DTRSNRSRSY NDSEDEYSES FIVSDEEEAD YGNSNVPDYD RDEIWAIFNR GKKRSYYDRY       300
     DNDDSGDDME ATGAEIWEEE RRSKRNAELE DRKELEEEQR LAALKKARKM KQR              353
//

If you have problems or comments...

PBIL Back to PBIL home page