(data stored in ACNUC6288 zone)

EMBL: CR382138.PE236

CR382138.PE236       Location/Qualifiers
FT   CDS             489470..491965
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05456g"
FT                   /old_locus_tag="DEHA0F05962g"
FT                   /old_locus_tag="DEHA-IPF8643"
FT                   /old_locus_tag="DEHA-CDS0753.1"
FT                   /product="DEHA2F05456p"
FT                   /note="weakly similar to uniprot|P47166 Saccharomyces
FT                   cerevisiae YJR134C SGM1 Protein of unknown function
FT                   required for wild-type growth rate on galactose and
FT                   mannose"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05456g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88924"
FT                   /db_xref="InterPro:IPR022091"
FT                   /db_xref="InterPro:IPR022092"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMH2"
FT                   /protein_id="CAG88924.2"
FT                   /translation="MAKKNNKKATKKNEVAKKDIDMKKPDTKAVEEGESQETDREESTV
FT                   DETAIEDPIISEDVSNIEPDTEQNNEVGIDHEQDIPAVVVSESNPTDTVVDSEEARQAS
FT                   IATTDTPPKTKKRLTLSERLALAAKGKKQRSSTPTPTSSAAGTPPATGSDEPKNVIIKE
FT                   ENDPLAENKVTIKDEEKVGKTGSESELASDGKYRDELKQLAAEIENLKANNSELSEENK
FT                   QLKSQSSKPGNINKETIQLKEQLASKDETIEQLMKEGQVLSVKELKLNESIKKLKASNN
FT                   DLEQSLNDYSKKNEQVLLKLNEQEDFLKKHKFKSINQLIDDYNDISKKLSQSNDDLEKE
FT                   KQLDWEGKYKEQQRLYETESSERKQSIKKLNELKIQFDMSKKQNSLELESKNTTINDLK
FT                   RSISSIRDENSKEIYRLENKIESLRVENERSPGSLSGNKDYNNCERNDTDTISNPKQID
FT                   YEEFVKLSNNHHSLQQQYLSSQENWKLIESNLLNKIDVLTSSVDSLKKSKSKSMNEIQK
FT                   LQNSLQRKMEEYDQLIEKFDELTNEKEEIVFQNQVKDTDYQELQEKFDKFQQIYNTDRQ
FT                   NLNSKIKQLTESLEKSKNNSNTSLGPFEQTSPNRQNLNGLHLNLEPPKLMKHHSSNSIN
FT                   DASYNNSGWPDIKFGESSTTPAVSREYSAVFMNRSHNNSSASLMDNVDTATELANDNYS
FT                   FNSKYPSHMGNGSISGIIPTSGNNNIQLINKMSSNIRRLEIELSTMKDENTQLSLDKEQ
FT                   AQQEILKQFKLMEEVNSLKKQITTLQTEIDQKSRQEETMLELIGEKSEQVEELRADVQD
FT                   LKDLCKLQVQQMIEIQESK"
     MAKKNNKKAT KKNEVAKKDI DMKKPDTKAV EEGESQETDR EESTVDETAI EDPIISEDVS        60
     NIEPDTEQNN EVGIDHEQDI PAVVVSESNP TDTVVDSEEA RQASIATTDT PPKTKKRLTL       120
     SERLALAAKG KKQRSSTPTP TSSAAGTPPA TGSDEPKNVI IKEENDPLAE NKVTIKDEEK       180
     VGKTGSESEL ASDGKYRDEL KQLAAEIENL KANNSELSEE NKQLKSQSSK PGNINKETIQ       240
     LKEQLASKDE TIEQLMKEGQ VLSVKELKLN ESIKKLKASN NDLEQSLNDY SKKNEQVLLK       300
     LNEQEDFLKK HKFKSINQLI DDYNDISKKL SQSNDDLEKE KQLDWEGKYK EQQRLYETES       360
     SERKQSIKKL NELKIQFDMS KKQNSLELES KNTTINDLKR SISSIRDENS KEIYRLENKI       420
     ESLRVENERS PGSLSGNKDY NNCERNDTDT ISNPKQIDYE EFVKLSNNHH SLQQQYLSSQ       480
     ENWKLIESNL LNKIDVLTSS VDSLKKSKSK SMNEIQKLQN SLQRKMEEYD QLIEKFDELT       540
     NEKEEIVFQN QVKDTDYQEL QEKFDKFQQI YNTDRQNLNS KIKQLTESLE KSKNNSNTSL       600
     GPFEQTSPNR QNLNGLHLNL EPPKLMKHHS SNSINDASYN NSGWPDIKFG ESSTTPAVSR       660
     EYSAVFMNRS HNNSSASLMD NVDTATELAN DNYSFNSKYP SHMGNGSISG IIPTSGNNNI       720
     QLINKMSSNI RRLEIELSTM KDENTQLSLD KEQAQQEILK QFKLMEEVNS LKKQITTLQT       780
     EIDQKSRQEE TMLELIGEKS EQVEELRADV QDLKDLCKLQ VQQMIEIQES K                831
//

If you have problems or comments...

PBIL Back to PBIL home page