(data stored in ACNUC6288 zone)

EMBL: CR382138.PE238

CR382138.PE238       Location/Qualifiers
FT   CDS             494390..497548
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05522g"
FT                   /old_locus_tag="IPF_8637"
FT                   /product="DEHA2F05522p"
FT                   /note="similar to uniprot|P46970 Saccharomyces cerevisiae
FT                   YJR132W NMD5 Karyopherin a carrier protein involved in
FT                   nuclear import of proteins"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05522g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66281"
FT                   /db_xref="GOA:B5RUA3"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUA3"
FT                   /protein_id="CAR66281.1"
FT                   /translation="MDANLLLECFSATLQSDQSVRHQAELQLRQLVLTPGFLGGCLDII
FT                   SSNNPAVSLPIKKAAAVFFKNRVVKYWGSEKQNKIDNDEKPGIRDRILPVLIESDYNTK
FT                   QQLIPVLRVLISYDFPNNWKDLLETTGALLQQVPVGATKDEDFSQLYTGLLCFSEISRK
FT                   FRWVSNSDRERELDAIIVQVFPHLLNIGNSIIANSENMTELTAEILKLILKVYKFVTYF
FT                   DLPVVLQTRESLIAWGEFHGSIVNMNTPTYVLSSTLSEQEKSFLQISKCYKWAVANLYR
FT                   IFTRYASKSLSKKFAYTDFQKMFCDDFIPHLITNFLSIIEQWCSKKRWLSLSCIYYLLQ
FT                   FLSHCVTQKPTWVLIKPYFENLVSHLIYPLLCPSDHVLEIFETDPHEYIHSNFDIYDEF
FT                   DTPDVAALGLLVTFVDKRKKTTLEPIIKFVYNQLTDLQQQPETLEVAKKREGALRLMGG
FT                   ISHYVVIPHSPYYSQMEQFLTALVFPNLSSKFDFLKARTLEVSSKFADLNFENKDNLSV
FT                   LFHGILNNFSTSNEESSLPVDFECALVIQAYIHLPEFQEALSTIILPTMSKLLDLSNQI
FT                   DNDAISAVMQECVENFSEQLQPFGVDLMAKLVEQFMRLAVDINEASKVDVDEFDGEYED
FT                   QTDKIMAAVGLLNTMITVLLSFENSREICAKLEEVFSPVIEFVLINKIDDFLTEVGELM
FT                   ENSTFLSRSISPIMWKNFTYLYQSFTDGIALMYTEELSQCLQNFLIYGQEDLMKSPQLV
FT                   ENFYNIFNIIIESEDAQVGFNDIVLACELAQTFILMLQTQAQAYIPNLVNSVLKISQSM
FT                   QQDEQHVKSSSFNITIQNVIIAAMVHDSNATLMNLQNHHQLVPFFVEWFKTISILKRVY
FT                   DLKLSTLGLISLMDNNEALNLLGNDIVAQIGSKLASIMKTLPKAIENLEHKRKNFSESE
FT                   FTSDQPYDDAWENHNDYDDDDDDVTGAQDLTHEPEASTTEYLDFLQQENVKLKNSGFFD
FT                   EEDLELIEDPLAASPLDSLNVFQIFKQFSQRLHANDNAKYSIIFGSLDVSDQKIFTDIF
FT                   EVVN"
     MDANLLLECF SATLQSDQSV RHQAELQLRQ LVLTPGFLGG CLDIISSNNP AVSLPIKKAA        60
     AVFFKNRVVK YWGSEKQNKI DNDEKPGIRD RILPVLIESD YNTKQQLIPV LRVLISYDFP       120
     NNWKDLLETT GALLQQVPVG ATKDEDFSQL YTGLLCFSEI SRKFRWVSNS DRERELDAII       180
     VQVFPHLLNI GNSIIANSEN MTELTAEILK LILKVYKFVT YFDLPVVLQT RESLIAWGEF       240
     HGSIVNMNTP TYVLSSTLSE QEKSFLQISK CYKWAVANLY RIFTRYASKS LSKKFAYTDF       300
     QKMFCDDFIP HLITNFLSII EQWCSKKRWL SLSCIYYLLQ FLSHCVTQKP TWVLIKPYFE       360
     NLVSHLIYPL LCPSDHVLEI FETDPHEYIH SNFDIYDEFD TPDVAALGLL VTFVDKRKKT       420
     TLEPIIKFVY NQLTDLQQQP ETLEVAKKRE GALRLMGGIS HYVVIPHSPY YSQMEQFLTA       480
     LVFPNLSSKF DFLKARTLEV SSKFADLNFE NKDNLSVLFH GILNNFSTSN EESSLPVDFE       540
     CALVIQAYIH LPEFQEALST IILPTMSKLL DLSNQIDNDA ISAVMQECVE NFSEQLQPFG       600
     VDLMAKLVEQ FMRLAVDINE ASKVDVDEFD GEYEDQTDKI MAAVGLLNTM ITVLLSFENS       660
     REICAKLEEV FSPVIEFVLI NKIDDFLTEV GELMENSTFL SRSISPIMWK NFTYLYQSFT       720
     DGIALMYTEE LSQCLQNFLI YGQEDLMKSP QLVENFYNIF NIIIESEDAQ VGFNDIVLAC       780
     ELAQTFILML QTQAQAYIPN LVNSVLKISQ SMQQDEQHVK SSSFNITIQN VIIAAMVHDS       840
     NATLMNLQNH HQLVPFFVEW FKTISILKRV YDLKLSTLGL ISLMDNNEAL NLLGNDIVAQ       900
     IGSKLASIMK TLPKAIENLE HKRKNFSESE FTSDQPYDDA WENHNDYDDD DDDVTGAQDL       960
     THEPEASTTE YLDFLQQENV KLKNSGFFDE EDLELIEDPL AASPLDSLNV FQIFKQFSQR      1020
     LHANDNAKYS IIFGSLDVSD QKIFTDIFEV VN                                    1052
//

If you have problems or comments...

PBIL Back to PBIL home page