(data stored in ACNUC6288 zone)

EMBL: CR382138.PE244

CR382138.PE244       Location/Qualifiers
FT   CDS             506695..508020
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05654g"
FT                   /old_locus_tag="DEHA0F06160g"
FT                   /old_locus_tag="DEHA-IPF8628"
FT                   /old_locus_tag="DEHA-CDS2813.1"
FT                   /product="DEHA2F05654p"
FT                   /note="some similarities with uniprot|Q04632 Saccharomyces
FT                   cerevisiae YML071C COG8 Component of the conserved
FT                   oligomeric Golgi complex (Cog1p through Cog8p) a cytosolic
FT                   tethering complex that functions in protein trafficking to
FT                   mediate fusion of transport vesicles to Golgi compartments
FT                   and similar to CA0131|IPF13402 Candida albicans IPF13402
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05654g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88932"
FT                   /db_xref="GOA:Q6BMG4"
FT                   /db_xref="InterPro:IPR007255"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMG4"
FT                   /protein_id="CAG88932.2"
FT                   /translation="MSGILLDTLSEDLDPTLAEFLKSNSELRQISEQYLVDLLINDDLL
FT                   CTDTYTTTSKSSNTDVSNVEGQPRTLTEEIAELDSQQREIKMQLASITNNNRDLIIDIS
FT                   KDLTSIREDVNSGFDKEINSMIKILDMENSNGEKFEIPENERLNNTMITYNSILSNIDS
FT                   VLDLLELPTLCKVCILQGNYQESLEISILVQTLVIRFPNLKIFQNIHYQVEQELKLMVK
FT                   GLIKLLNTNLKQNNILKIFQILNKLDLLNYNTSSAISSSVNVTSNKKLQKDKFLKIVYL
FT                   NARFKFIINELSNLTPLLKFNKLTYLKRYIEIYREFIFNSLSIYHAIFNFSPASNDIDI
FT                   KHEEDNLLISQFIKNLASLLAEELKKYLPELIAPSEKDDNIDKQTQKDGLILQIIYLCQ
FT                   SLAKYNVDFESLITWELCYRNNSILSEEDWLKNMAKVKKFRA"
     MSGILLDTLS EDLDPTLAEF LKSNSELRQI SEQYLVDLLI NDDLLCTDTY TTTSKSSNTD        60
     VSNVEGQPRT LTEEIAELDS QQREIKMQLA SITNNNRDLI IDISKDLTSI REDVNSGFDK       120
     EINSMIKILD MENSNGEKFE IPENERLNNT MITYNSILSN IDSVLDLLEL PTLCKVCILQ       180
     GNYQESLEIS ILVQTLVIRF PNLKIFQNIH YQVEQELKLM VKGLIKLLNT NLKQNNILKI       240
     FQILNKLDLL NYNTSSAISS SVNVTSNKKL QKDKFLKIVY LNARFKFIIN ELSNLTPLLK       300
     FNKLTYLKRY IEIYREFIFN SLSIYHAIFN FSPASNDIDI KHEEDNLLIS QFIKNLASLL       360
     AEELKKYLPE LIAPSEKDDN IDKQTQKDGL ILQIIYLCQS LAKYNVDFES LITWELCYRN       420
     NSILSEEDWL KNMAKVKKFR A                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page