(data stored in ACNUC6288 zone)

EMBL: CR382138.PE245

CR382138.PE245       Location/Qualifiers
FT   CDS             complement(508137..511622)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05676g"
FT                   /old_locus_tag="DEHA0F06182g"
FT                   /old_locus_tag="DEHA-IPF8626"
FT                   /old_locus_tag="DEHA-CDS0269.1"
FT                   /product="DEHA2F05676p"
FT                   /note="some similarities with uniprot|Q08562 Saccharomyces
FT                   cerevisiae YOR191W RIS1 Member of the SWI/SNF family of
FT                   DNA-dependent ATPases plays a role in antagonizing
FT                   silencing during mating-type switching contains an N-
FT                   terminal domain that interacts with Sir4p and a C-terminal
FT                   SNF2 domain and similar to CA4382|IPF8576 Candida albicans
FT                   IPF8576"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05676g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88933"
FT                   /db_xref="GOA:Q6BMG3"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMG3"
FT                   /protein_id="CAG88933.2"
FT                   /translation="MASDEPSQNIINLSSDDDEEVDENVSLKDIQINGHEIHERGNNQD
FT                   WRQANSNSNTTHINQPPKRQRLDSLYSNNGPFRSPSKQGNDLSHIGNSNHIQQRQLYPK
FT                   TLPNAVLDRTVFGPRSVSSNTTIQNHPRQSEPQSIPKNNLIQNQYMQADPQSIPNNNTI
FT                   QYQSRQADPQEDVIILSSEDEDMDSDGDIMILDAEEASRIGKFKTSSFERNANRSSRDM
FT                   GNYEAPANTGPYYSVPAVNPNEMHVTYNNPAPVPHFTKDDGPEVEKLNFQRAQETLEEN
FT                   VRRKDELLYKHEQLTSDFTKSSRQANELLQHLTLLQSHLKREEIQENRDENTILSLKNE
FT                   ISFKGAEYHNFRRSKDATATSLSGIASKLSWLTVSIRDAKSRIHNYGKHRNGVNIIDNP
FT                   FVLNNNSGRNNSDYENESIMNNPFGNIPGFSANVYSDNDQQHLQNLLNNIRPDEELDEE
FT                   GLSLTPSELAITLLKHQRMGLAWLLRMEESKSKGGILADDMGLGKTVQTIALIMAHKSD
FT                   DDNRKTNLVIAPVSLLRQWAAEIESKIKPNAQIKIAIYHGSVKKNLRTFNSLKKYDVVL
FT                   TSYGTLSSEWKKHYQGPLEEARLSRNQNVIPDLDAGGTSYTSPFFATDAVFYRIILDEA
FT                   QNIKNKSAIASKASYCIKGIHRFCLSGTPIQNNVEELYPILRFLRIKPYNDESKFRSDI
FT                   VLPIRSKSSGYDDFDKKKSMQKLRALLRAILLRRSKNSLIDGKPILSLPDKLVTEDTVQ
FT                   MEDEELTYYRELEQGIQKKAKTLLASEKLGSTSSILTLLLRLRQACCHSFLVEMGRMKA
FT                   AESEATKTLITRDWKSMYVNIQKFDEDTINRIRNEVHQGNLLKGENEGESNTNSDEDLF
FT                   TCPICYDVLGYESIVLFSGCGHMICNNCIENFFERFETGDGSEGNRLASCFSCSKSIKE
FT                   NELIDYNMFHMIHQEGYDRDKIAEFYNINYSSNGKTTNMQKIRQLIQENKGFTPSAKME
FT                   KCMHLIKDVLENYPDEKIIIFSQFLSLFDLMKLVLANEKIPFLRYDGSMSLDEKNSTIK
FT                   QFYQGSTKVLLISLRAGNVGLTLTCASHVIIMDPFWNPYVEEQAMDRAHRIGQQRDVRV
FT                   HRILTEGSVEGRIMTLQNEKKEIISGALDEKGMKSVSKLGRQELGFLFGLNELR"
     MASDEPSQNI INLSSDDDEE VDENVSLKDI QINGHEIHER GNNQDWRQAN SNSNTTHINQ        60
     PPKRQRLDSL YSNNGPFRSP SKQGNDLSHI GNSNHIQQRQ LYPKTLPNAV LDRTVFGPRS       120
     VSSNTTIQNH PRQSEPQSIP KNNLIQNQYM QADPQSIPNN NTIQYQSRQA DPQEDVIILS       180
     SEDEDMDSDG DIMILDAEEA SRIGKFKTSS FERNANRSSR DMGNYEAPAN TGPYYSVPAV       240
     NPNEMHVTYN NPAPVPHFTK DDGPEVEKLN FQRAQETLEE NVRRKDELLY KHEQLTSDFT       300
     KSSRQANELL QHLTLLQSHL KREEIQENRD ENTILSLKNE ISFKGAEYHN FRRSKDATAT       360
     SLSGIASKLS WLTVSIRDAK SRIHNYGKHR NGVNIIDNPF VLNNNSGRNN SDYENESIMN       420
     NPFGNIPGFS ANVYSDNDQQ HLQNLLNNIR PDEELDEEGL SLTPSELAIT LLKHQRMGLA       480
     WLLRMEESKS KGGILADDMG LGKTVQTIAL IMAHKSDDDN RKTNLVIAPV SLLRQWAAEI       540
     ESKIKPNAQI KIAIYHGSVK KNLRTFNSLK KYDVVLTSYG TLSSEWKKHY QGPLEEARLS       600
     RNQNVIPDLD AGGTSYTSPF FATDAVFYRI ILDEAQNIKN KSAIASKASY CIKGIHRFCL       660
     SGTPIQNNVE ELYPILRFLR IKPYNDESKF RSDIVLPIRS KSSGYDDFDK KKSMQKLRAL       720
     LRAILLRRSK NSLIDGKPIL SLPDKLVTED TVQMEDEELT YYRELEQGIQ KKAKTLLASE       780
     KLGSTSSILT LLLRLRQACC HSFLVEMGRM KAAESEATKT LITRDWKSMY VNIQKFDEDT       840
     INRIRNEVHQ GNLLKGENEG ESNTNSDEDL FTCPICYDVL GYESIVLFSG CGHMICNNCI       900
     ENFFERFETG DGSEGNRLAS CFSCSKSIKE NELIDYNMFH MIHQEGYDRD KIAEFYNINY       960
     SSNGKTTNMQ KIRQLIQENK GFTPSAKMEK CMHLIKDVLE NYPDEKIIIF SQFLSLFDLM      1020
     KLVLANEKIP FLRYDGSMSL DEKNSTIKQF YQGSTKVLLI SLRAGNVGLT LTCASHVIIM      1080
     DPFWNPYVEE QAMDRAHRIG QQRDVRVHRI LTEGSVEGRI MTLQNEKKEI ISGALDEKGM      1140
     KSVSKLGRQE LGFLFGLNEL R                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page