(data stored in ACNUC6288 zone)

EMBL: CR382138.PE246

CR382138.PE246       Location/Qualifiers
FT   CDS             complement(511862..512467)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05698g"
FT                   /old_locus_tag="DEHA0F06204g"
FT                   /old_locus_tag="DEHA-IPF8624"
FT                   /old_locus_tag="DEHA-CDS5349.1"
FT                   /product="DEHA2F05698p"
FT                   /note="similar to uniprot|P39742 Saccharomyces cerevisiae
FT                   YLR292C SEC72 Non-essential subunit of Sec63 complex
FT                   (Sec63p Sec62p Sec66p and Sec72p)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05698g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88934"
FT                   /db_xref="GOA:Q6BMG2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMG2"
FT                   /protein_id="CAG88934.1"
FT                   /translation="MNVALGYDAKTKKISLPDEAEKLVPSLKLEVDQLNTLTSELIANG
FT                   ADVPAPPTQENFNKDMTKMIRKLYEGGVQAFKQGKFQESAKQFTIGIDMICRRHKFEAF
FT                   QGTLQELSLFLMSRADAYLKTKNYLGAFNDADMLLGMMMCTPDNFLRRGVANYFLGNYE
FT                   AARADYQRGLAFDEDNERLVTELEICLDKILEENGDYL"
     MNVALGYDAK TKKISLPDEA EKLVPSLKLE VDQLNTLTSE LIANGADVPA PPTQENFNKD        60
     MTKMIRKLYE GGVQAFKQGK FQESAKQFTI GIDMICRRHK FEAFQGTLQE LSLFLMSRAD       120
     AYLKTKNYLG AFNDADMLLG MMMCTPDNFL RRGVANYFLG NYEAARADYQ RGLAFDEDNE       180
     RLVTELEICL DKILEENGDY L                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page