(data stored in ACNUC6288 zone)

EMBL: CR382138.PE252

CR382138.PE252       Location/Qualifiers
FT   CDS             521698..523464
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05830g"
FT                   /old_locus_tag="DEHA0F06336g"
FT                   /old_locus_tag="DEHA-IPF8611"
FT                   /old_locus_tag="DEHA-CDS1702.1"
FT                   /product="DEHA2F05830p"
FT                   /note="similar to uniprot|P32461 Saccharomyces cerevisiae
FT                   YKL191W DPH2 Protein required along with Dph1p Kti11p Jjj3p
FT                   and Dph5p for synthesis of diphthamide which is a modified
FT                   histidine residue of translation elongation factor 2 (Eft1p
FT                   or Eft2p)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05830g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88940"
FT                   /db_xref="GOA:Q6BMF6"
FT                   /db_xref="InterPro:IPR010014"
FT                   /db_xref="InterPro:IPR016435"
FT                   /db_xref="InterPro:IPR042263"
FT                   /db_xref="InterPro:IPR042264"
FT                   /db_xref="InterPro:IPR042265"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMF6"
FT                   /protein_id="CAG88940.2"
FT                   /translation="MTTEGLVVPALSTQQDDSTFEFDKVCSKTVVRSHLGLPNDATDDQ
FT                   VIKRIREYYNISEICNFLKQKVEGHELDMIPKYKHVTLQFPDSLICDSASIVHELQREL
FT                   GLMPRTEDSSEVKCSADSCCKTGKVESPLSQKLWILADTSYSSCCIDEVAAGHVNSDLV
FT                   IHFGDACLNVVESLPAAYVFGKPSLKLDSVITQFKEIYANRDSKILIMADAPHTQSLNQ
FT                   LYNILKPEYPNLAYADLYLNPSSNASIIGYDPCPSQSSILNVLNRTIIGLDNGDIDTDI
FT                   DTILLEHDLFHIEVPAVPRLLQLTTRFQSVTTFEPKSGLASQGPYPKLMRRYRYMHMAR
FT                   SAGTVGLLVNTLSLANTKTLINKIGQKIKEAGKKHYVFVVGKPNVAKLANFENIDIWCV
FT                   LGCDHQGIIIDENNEYYKPIVTPYELLLALNKDQNWSGKWVTDFNKVLEDMSLEDERNK
FT                   QEINDGSDNNEEDSDDEAPEFNPVTGQYVSTSKPLRKLHHLQISSQEQHPELDNEGSQD
FT                   LVKKFSSAVAIKDTVSTSAMHLQTRHWTGLGSDFQQNDSDEEANNEDGALVEDGRAGIA
FT                   RGYDYDRETKFQ"
     MTTEGLVVPA LSTQQDDSTF EFDKVCSKTV VRSHLGLPND ATDDQVIKRI REYYNISEIC        60
     NFLKQKVEGH ELDMIPKYKH VTLQFPDSLI CDSASIVHEL QRELGLMPRT EDSSEVKCSA       120
     DSCCKTGKVE SPLSQKLWIL ADTSYSSCCI DEVAAGHVNS DLVIHFGDAC LNVVESLPAA       180
     YVFGKPSLKL DSVITQFKEI YANRDSKILI MADAPHTQSL NQLYNILKPE YPNLAYADLY       240
     LNPSSNASII GYDPCPSQSS ILNVLNRTII GLDNGDIDTD IDTILLEHDL FHIEVPAVPR       300
     LLQLTTRFQS VTTFEPKSGL ASQGPYPKLM RRYRYMHMAR SAGTVGLLVN TLSLANTKTL       360
     INKIGQKIKE AGKKHYVFVV GKPNVAKLAN FENIDIWCVL GCDHQGIIID ENNEYYKPIV       420
     TPYELLLALN KDQNWSGKWV TDFNKVLEDM SLEDERNKQE INDGSDNNEE DSDDEAPEFN       480
     PVTGQYVSTS KPLRKLHHLQ ISSQEQHPEL DNEGSQDLVK KFSSAVAIKD TVSTSAMHLQ       540
     TRHWTGLGSD FQQNDSDEEA NNEDGALVED GRAGIARGYD YDRETKFQ                    588
//

If you have problems or comments...

PBIL Back to PBIL home page