(data stored in ACNUC6288 zone)

EMBL: CR382138.PE254

CR382138.PE254       Location/Qualifiers
FT   CDS             complement(join(524789..525284,525364..525392))
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05874g"
FT                   /product="DEHA2F05874p"
FT                   /note="weakly similar to uniprot|Q04969 Saccharomyces
FT                   cerevisiae YML055W SPC2 Subunit of signal peptidase complex
FT                   (Spc1p Spc2p Spc3p Sec11p)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05874g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66282"
FT                   /db_xref="GOA:B5RUA4"
FT                   /db_xref="InterPro:IPR009582"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUA4"
FT                   /protein_id="CAR66282.1"
FT                   /translation="MSAIKKTNLNSIVQLRATCDDNLHASLSELGYTQSFSLIDTKLAL
FT                   GYSTVVIAGLLYVVDKKFGFEKTYNVTVLSVILYFLISGILFYLTSTKKYKNVKYIGYD
FT                   DSNKKISVATWTNKYDPIYHLKIRFNDEESLAIVTSFEFMKVFDAFGYYKQDELTRLLK
FT                   NELDKINKKSN"
     MSAIKKTNLN SIVQLRATCD DNLHASLSEL GYTQSFSLID TKLALGYSTV VIAGLLYVVD        60
     KKFGFEKTYN VTVLSVILYF LISGILFYLT STKKYKNVKY IGYDDSNKKI SVATWTNKYD       120
     PIYHLKIRFN DEESLAIVTS FEFMKVFDAF GYYKQDELTR LLKNELDKIN KKSN             174
//

If you have problems or comments...

PBIL Back to PBIL home page