(data stored in ACNUC6288 zone)

EMBL: CR382138.PE269

CR382138.PE269       Location/Qualifiers
FT   CDS             join(550977..551092,551534..552929)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06226g"
FT                   /product="DEHA2F06226p"
FT                   /note="highly similar to uniprot|P00830 Saccharomyces
FT                   cerevisiae YJR121W ATP2 subunit of mitochondrial F1F0 ATP
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06226g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88959"
FT                   /db_xref="GOA:Q6BME0"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BME0"
FT                   /protein_id="CAG88959.1"
FT                   /translation="MVFPRLFNSASRNAFTAAKRNFVFNRGLASAAPVAGKVRAVIGAV
FT                   VDIQFDEGNLPAILNALTLKNGDQDLVLEVAQHLGENTVRAIAMDGTDGLVRGAPVNDT
FT                   GAPISVPVGRETLGRIINVIGEPIDERGPIKTKQKNPIHADPPSFVEQSTSSEVLETGI
FT                   KVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFAGVGERTREGNDL
FT                   YREMQETGVINLEGDSKVSLVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFVD
FT                   NIYRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVPAD
FT                   DLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDIAVVGKEHYDVASGV
FT                   QQTLQAYKSLQDIIAILGMDELSEQDKLTVERARKIQRFLSQPFAVAEVFTGIPGKLVR
FT                   LQETVKSFKEVLDGKHDHLPENAFYMVGGIEDATAKAEKLASESK"
     MVFPRLFNSA SRNAFTAAKR NFVFNRGLAS AAPVAGKVRA VIGAVVDIQF DEGNLPAILN        60
     ALTLKNGDQD LVLEVAQHLG ENTVRAIAMD GTDGLVRGAP VNDTGAPISV PVGRETLGRI       120
     INVIGEPIDE RGPIKTKQKN PIHADPPSFV EQSTSSEVLE TGIKVVDLLA PYARGGKIGL       180
     FGGAGVGKTV FIQELINNIA KAHGGFSVFA GVGERTREGN DLYREMQETG VINLEGDSKV       240
     SLVFGQMNEP PGARARVALT GLTIAEYFRD EEGQDVLLFV DNIYRFTQAG SEVSALLGRI       300
     PSAVGYQPTL ATDMGLLQER ITTTKKGSVT SVQAVYVPAD DLTDPAPATT FAHLDATTVL       360
     SRGISELGIY PAVDPLDSKS RLLDIAVVGK EHYDVASGVQ QTLQAYKSLQ DIIAILGMDE       420
     LSEQDKLTVE RARKIQRFLS QPFAVAEVFT GIPGKLVRLQ ETVKSFKEVL DGKHDHLPEN       480
     AFYMVGGIED ATAKAEKLAS ESK                                               503
//

If you have problems or comments...

PBIL Back to PBIL home page