(data stored in ACNUC6288 zone)

EMBL: CR382138.PE271

CR382138.PE271       Location/Qualifiers
FT   CDS             complement(554700..555425)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06270g"
FT                   /old_locus_tag="DEHA0F06842g"
FT                   /old_locus_tag="DEHA-IPF8578"
FT                   /old_locus_tag="DEHA-CDS4920.1"
FT                   /product="DEHA2F06270p"
FT                   /note="similar to uniprot|Q07508 Saccharomyces cerevisiae
FT                   YDL087C LUC7 Essential protein associated with the U1 snRNP
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06270g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88961"
FT                   /db_xref="GOA:Q6BMD8"
FT                   /db_xref="InterPro:IPR004882"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMD8"
FT                   /protein_id="CAG88961.1"
FT                   /translation="MAEEQRKLVEQLMGKDALISPAVKRRDPEMTSHRVCKSFLVGVCP
FT                   HDLFIGTKQDLGKCPKLHLEKHKLEYEYRTRKKGEAFPEFEYEYYKHLQTYINEIDRNI
FT                   EIALKRLEHTPEEKEKIAKVTKELDNLDTKIGLMTQEIDCLIKENETLKCLFESVKLND
FT                   LCKERDQLAESARNIAENVGQSSQQKLQVCEECGAYLSRLDSDRRLADHLIGKIHLGYV
FT                   QMRAAYYELHNKFKRSTTY"
     MAEEQRKLVE QLMGKDALIS PAVKRRDPEM TSHRVCKSFL VGVCPHDLFI GTKQDLGKCP        60
     KLHLEKHKLE YEYRTRKKGE AFPEFEYEYY KHLQTYINEI DRNIEIALKR LEHTPEEKEK       120
     IAKVTKELDN LDTKIGLMTQ EIDCLIKENE TLKCLFESVK LNDLCKERDQ LAESARNIAE       180
     NVGQSSQQKL QVCEECGAYL SRLDSDRRLA DHLIGKIHLG YVQMRAAYYE LHNKFKRSTT       240
     Y                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page