(data stored in ACNUC6288 zone)

EMBL: CR382138.PE280

CR382138.PE280       Location/Qualifiers
FT   CDS             576534..577232
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06512g"
FT                   /old_locus_tag="DEHA0F07172g"
FT                   /old_locus_tag="DEHA-IPF8555"
FT                   /old_locus_tag="DEHA-CDS5666.1"
FT                   /product="DEHA2F06512p"
FT                   /note="weakly similar to uniprot|P38242 Saccharomyces
FT                   cerevisiae YBR070C ALG14 Essential protein required for the
FT                   second step of dolichyl-linked oligosaccharide synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06512g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88973"
FT                   /db_xref="GOA:Q6BMD0"
FT                   /db_xref="InterPro:IPR013969"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMD0"
FT                   /protein_id="CAG88973.2"
FT                   /translation="MDFESQLCIKVVLLLLPFFIIGIRLLWVLPAVNSPAMGSEKEKGL
FT                   SQIPSELRGSNIMIFLGSGGHTGEMMRILANVDLNNFNRTWVTSSGDSTSILKCKKYED
FT                   ERLTSGQNKSDYLVLHRARTVGESIISSVFSTVRSLISTIKHLYELPQFPSILLLNGPG
FT                   TSVPLAYIIFLLKFLGLCKTRIIYIESLARVKQLSVSGLLILPITDRFIVQWKQLAVKY
FT                   KRAEYYGILI"
     MDFESQLCIK VVLLLLPFFI IGIRLLWVLP AVNSPAMGSE KEKGLSQIPS ELRGSNIMIF        60
     LGSGGHTGEM MRILANVDLN NFNRTWVTSS GDSTSILKCK KYEDERLTSG QNKSDYLVLH       120
     RARTVGESII SSVFSTVRSL ISTIKHLYEL PQFPSILLLN GPGTSVPLAY IIFLLKFLGL       180
     CKTRIIYIES LARVKQLSVS GLLILPITDR FIVQWKQLAV KYKRAEYYGI LI               232
//

If you have problems or comments...

PBIL Back to PBIL home page