(data stored in ACNUC6288 zone)

EMBL: CR382138.PE283

CR382138.PE283       Location/Qualifiers
FT   CDS             580491..582863
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06578g"
FT                   /old_locus_tag="DEHA0F07238g"
FT                   /old_locus_tag="DEHA-IPF8550"
FT                   /old_locus_tag="DEHA-CDS0866.1"
FT                   /product="DEHA2F06578p"
FT                   /note="weakly similar to uniprot|P32833 Saccharomyces
FT                   cerevisiae YBR060C ORC2 Subunit of the origin recognition
FT                   complex which directs DNA replication by binding to
FT                   replication origins and is also involved in transcriptional
FT                   silencing"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06578g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88976"
FT                   /db_xref="GOA:Q6BMC7"
FT                   /db_xref="InterPro:IPR007220"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMC7"
FT                   /protein_id="CAG88976.2"
FT                   /translation="MTFEEKSSPENKGFNDSDIFLTPSKKHVSLSATPSHRQSPFDLTL
FT                   SPNKSPSKRGVIKLEKTADDIVLFSPVKTPNGRAGLPSPKKRTIAELDKSARKRAISTS
FT                   GIYSKLMDDDLEENNNEYLDRQEVSLAEAIIKESRDNKQEDVDEYFRAYGSDVELEEDL
FT                   TVNKKPKRRGRKPKKEVKVEEDDEIDDEDIEIEDDGELEDDDDEEFKLPKKERKAKNKR
FT                   IIREVSDIDDISEEDEAEKEILPKRQKITASPFAVTSVDEAISPSKRKVGRPSKASKVI
FT                   GKIKSIFQMDDEAFFTENKQATNRIKENADTSDVTKDSDSFFSMTLDNVTQSSIVSVPT
FT                   VSGIPNTKEGKRKVEVATVDSNKFIPLPIPNINEEGEIEDEEYVKKYLPNVNIEEKYSG
FT                   RLIDERAFFLDGTEGYFEQHMGRPKASANSLSQLAPPLEYDEFIPYVELSKLIRSKEKN
FT                   KLNDLHKSLYHQWCFELTCGFSLNFYGVGSKIKLIGDFVQNYLVDWYEQNMQEDEEYPD
FT                   ILVVNGYNPAVKFKKVAHDILSVFISQEKKKQDNVKFPKHISETIPFLMKYVEDRRVHR
FT                   PGQFIKPKLILVIHNIDGKPFLNERTQSLLSQLCSIPEIWLISSTDNINVSLLWDSFKL
FT                   KSFNFLWHDLTTYEPYTVEMSFRDVLSMGKSKKFVGNKGAKYVLSSLTKNARNLYKILL
FT                   TKQLEIMRNTTTTKAGRNGLKGSIKLGIEFKQLYNTCLEEFVTSNEISFRTMLGEFVEH
FT                   KMCSAVKDEAGVEMVFVPFNFDEMEKLLAEEFASNEM"
     MTFEEKSSPE NKGFNDSDIF LTPSKKHVSL SATPSHRQSP FDLTLSPNKS PSKRGVIKLE        60
     KTADDIVLFS PVKTPNGRAG LPSPKKRTIA ELDKSARKRA ISTSGIYSKL MDDDLEENNN       120
     EYLDRQEVSL AEAIIKESRD NKQEDVDEYF RAYGSDVELE EDLTVNKKPK RRGRKPKKEV       180
     KVEEDDEIDD EDIEIEDDGE LEDDDDEEFK LPKKERKAKN KRIIREVSDI DDISEEDEAE       240
     KEILPKRQKI TASPFAVTSV DEAISPSKRK VGRPSKASKV IGKIKSIFQM DDEAFFTENK       300
     QATNRIKENA DTSDVTKDSD SFFSMTLDNV TQSSIVSVPT VSGIPNTKEG KRKVEVATVD       360
     SNKFIPLPIP NINEEGEIED EEYVKKYLPN VNIEEKYSGR LIDERAFFLD GTEGYFEQHM       420
     GRPKASANSL SQLAPPLEYD EFIPYVELSK LIRSKEKNKL NDLHKSLYHQ WCFELTCGFS       480
     LNFYGVGSKI KLIGDFVQNY LVDWYEQNMQ EDEEYPDILV VNGYNPAVKF KKVAHDILSV       540
     FISQEKKKQD NVKFPKHISE TIPFLMKYVE DRRVHRPGQF IKPKLILVIH NIDGKPFLNE       600
     RTQSLLSQLC SIPEIWLISS TDNINVSLLW DSFKLKSFNF LWHDLTTYEP YTVEMSFRDV       660
     LSMGKSKKFV GNKGAKYVLS SLTKNARNLY KILLTKQLEI MRNTTTTKAG RNGLKGSIKL       720
     GIEFKQLYNT CLEEFVTSNE ISFRTMLGEF VEHKMCSAVK DEAGVEMVFV PFNFDEMEKL       780
     LAEEFASNEM                                                              790
//

If you have problems or comments...

PBIL Back to PBIL home page