(data stored in ACNUC6288 zone)

EMBL: CR382138.PE285

CR382138.PE285       Location/Qualifiers
FT   CDS             586245..589085
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06622g"
FT                   /old_locus_tag="IPF_8541"
FT                   /product="DEHA2F06622p"
FT                   /note="similar to uniprot|P42842 Saccharomyces cerevisiae
FT                   YNL313C Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06622g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66285"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUA7"
FT                   /protein_id="CAR66285.1"
FT                   /translation="MSSEKYLRSVLSQLVLSISAEKVDVPSEISSDLQPVTNCILYILK
FT                   GVSSKLIHEQDYYSLLFTDASKKILESFPSNDLYTVLNEYLHEVINNFEQRFQEETISK
FT                   LHLQIIAIALLQTFIQLNFTGPGIEFNSQQLFFPGVDEKTVQLESIKLINIEGEQAYEL
FT                   MVDPLFFIISCLLFEKLMQVDSRLSLVNKTLLAPLEEIIEATGNICSASPDDPVKASLQ
FT                   WWRARALQVHLSLISEPASVLSSVSSLLLNPSVANALAPAIDDNLELKKHIQLVYFLEC
FT                   ARSGIHSQTEHLAIPLLGKARQLSELNFVISGAKAKRTKFQTFHTSALIILAKSKKSTL
FT                   FDNENDNPETFGLESDLLLEKPQFESLDDLELQDEPNSKRIKIDEISTINDEEGDEEKL
FT                   LPIAMRQDDIPDELKALDPNEQPALNDLDSVQLLLRLTTLRQTTPSNNPLVEEELLALA
FT                   SRILYASSKSVNWSIFSRALWERSILETTKARTIERGILQMTSLVEEIGIKVKTRIIPQ
FT                   AMEEGDEEGSSAAASRLRFIHQLPLMPQWAMDMRLAEKYMSLGVLRSAVEIYERLQLSC
FT                   ETALCYAAADEEKEAERIILERINSHPEDARAVSILGDIRQDPNLWIKAWEIGKYSKAK
FT                   ASLSRYFYNPPQSSGLTKDLEQAIKHMNDCLTANPLSYEHWFFYGCCGLESHQYEVAAE
FT                   AFTRCVALDDTNSHAWSNLASALLRTDKTRPALNALKKAIRCAGESNKSWRIYENYLIV
FT                   AAKLNEWNDVLIAARELINIRGNSDGEGSIDIPIIEKLVEILVATEYPSAEDTRFTHYQ
FT                   KSCIDLVCNILPSVITKSARCWRIVARVELWRQKPWAALECHEKAYRALSQRPELETDE
FT                   SAWNEAIDSCSDLVAAYESLGELPGKHDAGDLVCKDWKYKAKTTVRSLMSKGKAMWEDS
FT                   EGWYRLQDMKEQLLNN"
     MSSEKYLRSV LSQLVLSISA EKVDVPSEIS SDLQPVTNCI LYILKGVSSK LIHEQDYYSL        60
     LFTDASKKIL ESFPSNDLYT VLNEYLHEVI NNFEQRFQEE TISKLHLQII AIALLQTFIQ       120
     LNFTGPGIEF NSQQLFFPGV DEKTVQLESI KLINIEGEQA YELMVDPLFF IISCLLFEKL       180
     MQVDSRLSLV NKTLLAPLEE IIEATGNICS ASPDDPVKAS LQWWRARALQ VHLSLISEPA       240
     SVLSSVSSLL LNPSVANALA PAIDDNLELK KHIQLVYFLE CARSGIHSQT EHLAIPLLGK       300
     ARQLSELNFV ISGAKAKRTK FQTFHTSALI ILAKSKKSTL FDNENDNPET FGLESDLLLE       360
     KPQFESLDDL ELQDEPNSKR IKIDEISTIN DEEGDEEKLL PIAMRQDDIP DELKALDPNE       420
     QPALNDLDSV QLLLRLTTLR QTTPSNNPLV EEELLALASR ILYASSKSVN WSIFSRALWE       480
     RSILETTKAR TIERGILQMT SLVEEIGIKV KTRIIPQAME EGDEEGSSAA ASRLRFIHQL       540
     PLMPQWAMDM RLAEKYMSLG VLRSAVEIYE RLQLSCETAL CYAAADEEKE AERIILERIN       600
     SHPEDARAVS ILGDIRQDPN LWIKAWEIGK YSKAKASLSR YFYNPPQSSG LTKDLEQAIK       660
     HMNDCLTANP LSYEHWFFYG CCGLESHQYE VAAEAFTRCV ALDDTNSHAW SNLASALLRT       720
     DKTRPALNAL KKAIRCAGES NKSWRIYENY LIVAAKLNEW NDVLIAAREL INIRGNSDGE       780
     GSIDIPIIEK LVEILVATEY PSAEDTRFTH YQKSCIDLVC NILPSVITKS ARCWRIVARV       840
     ELWRQKPWAA LECHEKAYRA LSQRPELETD ESAWNEAIDS CSDLVAAYES LGELPGKHDA       900
     GDLVCKDWKY KAKTTVRSLM SKGKAMWEDS EGWYRLQDMK EQLLNN                      946
//

If you have problems or comments...

PBIL Back to PBIL home page