(data stored in ACNUC6288 zone)

EMBL: CR382138.PE289

CR382138.PE289       Location/Qualifiers
FT   CDS             complement(join(592448..595775,595852..595874))
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06710g"
FT                   /product="DEHA2F06710p"
FT                   /note="similar to uniprot|P38426 Saccharomyces cerevisiae
FT                   YMR261C TPS3 115 kD regulatory subunit of trehalose-6-
FT                   phosphate synthase/phosphatase complex"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06710g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88983"
FT                   /db_xref="GOA:Q6BMC0"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMC0"
FT                   /protein_id="CAG88983.2"
FT                   /translation="MTIIIGTLFLPYTVKFDVGGRVDYDIDITQKDATVPNIQNDARNQ
FT                   QRKSVSAGMGTGISQSSILPSLSTSQQHTPRSGSPTFNDNASIMTGSDTDQVNSAQEFF
FT                   HSHKRTPHDSQNILTDNLYDKLGSKLIQPRSRYSNVAFQSSVVDPKKKSEDAGLPGLKI
FT                   NRSSNNLTSLNNSSFSSYSNMIGLNPTTNSSTMSVPSTRQRTPISRQGFTLHSNSSSNS
FT                   IPTRIKEVEEEEARESDYASDKSVDEDHIENFNDLVHGRTESKLTPFGGFSKPDLEDGI
FT                   LNQENIFEDAPWKVVLAGKGNVSLTKAVQIAVDAGGINDHKWVGTLAMPSDAVPNSVIN
FT                   GISDSLSENYDCEAVFPNDITFQGHYKSFCKQILWPTLHYQIPDDPKSKAFEDHSWGHY
FT                   KLLNQLVADKIVDLYKKENGSSDPNDPNNMIWIHDYHLLLVPKMIREKLPEAKIGLFLH
FT                   VSFPSSEVFRCFAQRKAILSGMLGANCITFQTDEYVRHFWQTCNRLLLADANEFGITYE
FT                   GKFTMINTIPVGVDAKSLEGYLGSNEVNEWRNMIRERWSNKKLIVSRDKLEKLRGIKQK
FT                   LLAYEKFLHSNPEYVDTTVLIQICPGTTQDSSYESEIMSIVGRINALTGDISFSQPVVL
FT                   LQQDIGFEQYVALQCEAEVFVVASMREGLNLTCHEYIIATTEKKSPLMLSEFTGSSPLL
FT                   NCNGEGAILINPWDLKRFAELFKVSLDMGQDEKVKRWTNCYKTICNHDSRNWVENCLQG
FT                   INEGWDYDHSRNLNKLIPFTRDIFDSFYSRNDGGKRLFFLNLDTPSAIASTNDPSSKFH
FT                   KLTSKSAVAAAGKNGAFSESSRFASLLNELLSDPLNHVYLTSYLKRSDLDTLYNRSPNL
FT                   GLVAENGGYIKLTESDKWISIIDEVELEGWMPQVSQLIASKVERLPGSHMEVEDCTIRF
FT                   HPGKSFENDRERSLSILGDCIQHVNELFSDQDGVHATLIRNVLIVQKNKLSMKALKFII
FT                   SYYNQKKQGIKSESLIEEYQVKQVPGSAPSTPISETASLPPIKSPTSKIQKNLVTALFL
FT                   SGGSTLIDEPGYEYANGLERSGEIPEVITVTVLGADSRTSATYCVSGKNELLGILSNPV
FT                   SEPYKSHTA"
     MTIIIGTLFL PYTVKFDVGG RVDYDIDITQ KDATVPNIQN DARNQQRKSV SAGMGTGISQ        60
     SSILPSLSTS QQHTPRSGSP TFNDNASIMT GSDTDQVNSA QEFFHSHKRT PHDSQNILTD       120
     NLYDKLGSKL IQPRSRYSNV AFQSSVVDPK KKSEDAGLPG LKINRSSNNL TSLNNSSFSS       180
     YSNMIGLNPT TNSSTMSVPS TRQRTPISRQ GFTLHSNSSS NSIPTRIKEV EEEEARESDY       240
     ASDKSVDEDH IENFNDLVHG RTESKLTPFG GFSKPDLEDG ILNQENIFED APWKVVLAGK       300
     GNVSLTKAVQ IAVDAGGIND HKWVGTLAMP SDAVPNSVIN GISDSLSENY DCEAVFPNDI       360
     TFQGHYKSFC KQILWPTLHY QIPDDPKSKA FEDHSWGHYK LLNQLVADKI VDLYKKENGS       420
     SDPNDPNNMI WIHDYHLLLV PKMIREKLPE AKIGLFLHVS FPSSEVFRCF AQRKAILSGM       480
     LGANCITFQT DEYVRHFWQT CNRLLLADAN EFGITYEGKF TMINTIPVGV DAKSLEGYLG       540
     SNEVNEWRNM IRERWSNKKL IVSRDKLEKL RGIKQKLLAY EKFLHSNPEY VDTTVLIQIC       600
     PGTTQDSSYE SEIMSIVGRI NALTGDISFS QPVVLLQQDI GFEQYVALQC EAEVFVVASM       660
     REGLNLTCHE YIIATTEKKS PLMLSEFTGS SPLLNCNGEG AILINPWDLK RFAELFKVSL       720
     DMGQDEKVKR WTNCYKTICN HDSRNWVENC LQGINEGWDY DHSRNLNKLI PFTRDIFDSF       780
     YSRNDGGKRL FFLNLDTPSA IASTNDPSSK FHKLTSKSAV AAAGKNGAFS ESSRFASLLN       840
     ELLSDPLNHV YLTSYLKRSD LDTLYNRSPN LGLVAENGGY IKLTESDKWI SIIDEVELEG       900
     WMPQVSQLIA SKVERLPGSH MEVEDCTIRF HPGKSFENDR ERSLSILGDC IQHVNELFSD       960
     QDGVHATLIR NVLIVQKNKL SMKALKFIIS YYNQKKQGIK SESLIEEYQV KQVPGSAPST      1020
     PISETASLPP IKSPTSKIQK NLVTALFLSG GSTLIDEPGY EYANGLERSG EIPEVITVTV      1080
     LGADSRTSAT YCVSGKNELL GILSNPVSEP YKSHTA                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page