(data stored in ACNUC6288 zone)

EMBL: CR382138.PE31

CR382138.PE31        Location/Qualifiers
FT   CDS             77245..77517
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00836g"
FT                   /old_locus_tag="DEHA0F01023g"
FT                   /old_locus_tag="DEHA-IPF9036"
FT                   /old_locus_tag="DEHA-CDS7576.1"
FT                   /product="DEHA2F00836p"
FT                   /note="similar to uniprot|P57744 Saccharomyces cerevisiae
FT                   YJR135W-A TIM8 Mitochondrial intermembrane space protein
FT                   mediating import and insertion of polytopic inner membrane
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00836g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88701"
FT                   /db_xref="GOA:Q6BN23"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="InterPro:IPR035427"
FT                   /db_xref="InterPro:IPR039238"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BN23"
FT                   /protein_id="CAG88701.1"
FT                   /translation="MSQISQTALASLDESSRKDIMQFIESENSKSKVQMSIHNFTDMCF
FT                   KKCNANKPITSGTLDSSEEQCLTNCLNRFLDTNIKVVQALQGAQK"
     MSQISQTALA SLDESSRKDI MQFIESENSK SKVQMSIHNF TDMCFKKCNA NKPITSGTLD        60
     SSEEQCLTNC LNRFLDTNIK VVQALQGAQK                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page