(data stored in ACNUC6288 zone)

EMBL: CR382138.PE316

CR382138.PE316       Location/Qualifiers
FT   CDS             complement(639187..639996)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07370g"
FT                   /old_locus_tag="DEHA0F08184g"
FT                   /old_locus_tag="DEHA-IPF8487"
FT                   /old_locus_tag="DEHA-CDS4593.1"
FT                   /product="DEHA2F07370p"
FT                   /note="similar to uniprot|P29478 Saccharomyces cerevisiae
FT                   YML105C SEC65 signal recognition particle subunit homologue
FT                   of mammalian SRP19"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07370g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89015"
FT                   /db_xref="GOA:Q6BM93"
FT                   /db_xref="InterPro:IPR002778"
FT                   /db_xref="InterPro:IPR036521"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BM93"
FT                   /protein_id="CAG89015.1"
FT                   /translation="MAKRPVLEDVLDDEIDNMDMDIAQFDPSLRTPIAPVQPGPQITRS
FT                   QDQEPPLFPNFPHPEQDKSVERKDIVDPNKFSAEERAELKKFQIIYPCYFDKSRSHKDG
FT                   RRVSESKAVSNPLAKTISDACRHYNLPVMLELDKTHPQDFGNPGRVRVLIKDNNKNGMP
FT                   VDSRFKTKRAVLNIIADYLKTHPTTLASIGPKSGIPLPSEYETGFEPGEIPKVKGFKMN
FT                   TIVPVHSELTIKHPMTKSIYDPEPEQPQVKAPQAPKQPKKKVMKIRG"
     MAKRPVLEDV LDDEIDNMDM DIAQFDPSLR TPIAPVQPGP QITRSQDQEP PLFPNFPHPE        60
     QDKSVERKDI VDPNKFSAEE RAELKKFQII YPCYFDKSRS HKDGRRVSES KAVSNPLAKT       120
     ISDACRHYNL PVMLELDKTH PQDFGNPGRV RVLIKDNNKN GMPVDSRFKT KRAVLNIIAD       180
     YLKTHPTTLA SIGPKSGIPL PSEYETGFEP GEIPKVKGFK MNTIVPVHSE LTIKHPMTKS       240
     IYDPEPEQPQ VKAPQAPKQP KKKVMKIRG                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page