(data stored in ACNUC6288 zone)

EMBL: CR382138.PE322

CR382138.PE322       Location/Qualifiers
FT   CDS             654096..654701
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07502g"
FT                   /old_locus_tag="DEHA0F08316g"
FT                   /old_locus_tag="DEHA-IPF8476"
FT                   /old_locus_tag="DEHA-CDS5348.1"
FT                   /product="DEHA2F07502p"
FT                   /note="similar to uniprot|P43582 Saccharomyces cerevisiae
FT                   YFL010C WWM1 WW domain containing protein interacting with
FT                   Metacaspase (MCA1)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07502g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89021"
FT                   /db_xref="GOA:Q6BM87"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR036020"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM87"
FT                   /protein_id="CAG89021.1"
FT                   /translation="MVTNDSKNTPNVPEGWLAKFDDKYNTFFYVNLKTKKSQWEAPSGT
FT                   SFEPKSADEVLPPPYSPTSSSGARAQYQTQDRPQAQPQVQSQPQPHVQQYPPQQGYPQG
FT                   YPPQGYGYPPQQGYPPQGYGYPPQQQYMQQKPQRSRMGGMGGLGMGLGGGMLGGMLLGN
FT                   MMGNNEMEAYHDGFQDGGMSGGDDMGGDMGGDMGGGDF"
     MVTNDSKNTP NVPEGWLAKF DDKYNTFFYV NLKTKKSQWE APSGTSFEPK SADEVLPPPY        60
     SPTSSSGARA QYQTQDRPQA QPQVQSQPQP HVQQYPPQQG YPQGYPPQGY GYPPQQGYPP       120
     QGYGYPPQQQ YMQQKPQRSR MGGMGGLGMG LGGGMLGGML LGNMMGNNEM EAYHDGFQDG       180
     GMSGGDDMGG DMGGDMGGGD F                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page