(data stored in ACNUC6288 zone)

EMBL: CR382138.PE326

CR382138.PE326       Location/Qualifiers
FT   CDS             complement(657965..659737)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07590g"
FT                   /old_locus_tag="DEHA0F08404g"
FT                   /old_locus_tag="DEHA-IPF8469"
FT                   /old_locus_tag="DEHA-CDS1691.1"
FT                   /product="DEHA2F07590p"
FT                   /note="highly similar to uniprot|P15624 Saccharomyces
FT                   cerevisiae YLR060W FRS1 Beta subunit of cytoplasmic
FT                   phenylalanyl-tRNA synthetase forms a tetramer with Frs2p to
FT                   generate the active enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07590g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89025"
FT                   /db_xref="GOA:Q6BM83"
FT                   /db_xref="InterPro:IPR004531"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR040659"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM83"
FT                   /protein_id="CAG89025.2"
FT                   /translation="MPTIPVDKQDLFDLLGRSYTTEEFDELCFEFGIELDEDTTEECKG
FT                   DERPQFKIEVPANRYDMLCIEGIAQALNEFLGKKSSPGFKYNPSKPEISLTIHKSTEQV
FT                   RPYAASAILRNVQLDERRYDSFLALQDKLHTNLCRNRTLVAIGTHDLDTLTPPFTYEAL
FT                   PPSEINFIPLNQEKEMDGNQLMEFYEKDKHLGKYLHIIKDSPVYPVILDANRTVCSLPP
FT                   IINSNHSKISAQTRNIFIDVTGTDRTKTEIVINQLVAMFAGYCKVPFEIEPIEIKSEHN
FT                   KQDRITPDISARPFEAEIPYINSCLGLDLTGQEISDLLKRMSLHAKPSSKKDLIDIGIP
FT                   ITRPDILHQCDIMEDAAIAYGYNNLTKTKAKGDSLVAAPLPVNKIGDILRIASAQAGYL
FT                   EVLPLTLCSHDENFKFLRTKDDNTTAVKLENPKTIEYQVVRTTLVPGLLKTIKENRKHS
FT                   LPIKVFEAGDIVLKNPELERGAFNQRNWSAIYAGKTSGFEFVQGLLGKIMQTMRTSWLE
FT                   NPKESTERGYWIEQDDENPTFFPGRGAKVFFRAGDGSKEQHIGAIGVLHPEVMANFEIP
FT                   YAASSVEINAEVFL"
     MPTIPVDKQD LFDLLGRSYT TEEFDELCFE FGIELDEDTT EECKGDERPQ FKIEVPANRY        60
     DMLCIEGIAQ ALNEFLGKKS SPGFKYNPSK PEISLTIHKS TEQVRPYAAS AILRNVQLDE       120
     RRYDSFLALQ DKLHTNLCRN RTLVAIGTHD LDTLTPPFTY EALPPSEINF IPLNQEKEMD       180
     GNQLMEFYEK DKHLGKYLHI IKDSPVYPVI LDANRTVCSL PPIINSNHSK ISAQTRNIFI       240
     DVTGTDRTKT EIVINQLVAM FAGYCKVPFE IEPIEIKSEH NKQDRITPDI SARPFEAEIP       300
     YINSCLGLDL TGQEISDLLK RMSLHAKPSS KKDLIDIGIP ITRPDILHQC DIMEDAAIAY       360
     GYNNLTKTKA KGDSLVAAPL PVNKIGDILR IASAQAGYLE VLPLTLCSHD ENFKFLRTKD       420
     DNTTAVKLEN PKTIEYQVVR TTLVPGLLKT IKENRKHSLP IKVFEAGDIV LKNPELERGA       480
     FNQRNWSAIY AGKTSGFEFV QGLLGKIMQT MRTSWLENPK ESTERGYWIE QDDENPTFFP       540
     GRGAKVFFRA GDGSKEQHIG AIGVLHPEVM ANFEIPYAAS SVEINAEVFL                  590
//

If you have problems or comments...

PBIL Back to PBIL home page