(data stored in ACNUC6288 zone)

EMBL: CR382138.PE327

CR382138.PE327       Location/Qualifiers
FT   CDS             complement(659940..662840)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07612g"
FT                   /old_locus_tag="IPF_8466"
FT                   /product="DEHA2F07612p"
FT                   /note="similar to uniprot|P43564 Saccharomyces cerevisiae
FT                   YFL034W Possible integral membrane protein that interacts
FT                   with Rpp0p which is a component of the ribosomal stalk"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07612g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66292"
FT                   /db_xref="GOA:B5RUB4"
FT                   /db_xref="InterPro:IPR007941"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUB4"
FT                   /protein_id="CAR66292.1"
FT                   /translation="MDFKRTPSVDSLGTAHSVYSSKTPTRSRSNIGSRTSISVLPSLPT
FT                   NVSNESIEEDLHNHSNIDEKLEREATPETSYVEFDLSSMDQKNSRNDSNFLSEKIISPN
FT                   THRTDISDVEADKDEVSDVAKKPEDAENDFFDMKTSDWKSMKTITEQDYYNDKGELEYK
FT                   HANEFDPSKIKFDAHGYTKIDTEEQVTKYAELDKKTDFLFQSRREINKKTEAAAYRKED
FT                   LDYASDEDNSEYEDDDNLDSNETLQTMRNMLTDGQKFAYVGTTKLIAIDMATELAKIKQ
FT                   STSNKVAKELSLGQRNFANWTMYITSKLYEHMNLSKDEQNMIENLSKHGVEVTDLCSSL
FT                   NQREIIKPSKQNQTQENETDDSMKEIKGKTDNNEVAVDLRWTIICDLLLLLLSDGYYDS
FT                   RSRSLLVQFAEKMSISHLEILQFERRLIESLEIDTNNKSIENKDEKLNDREFIDKYKKK
FT                   NKKKRYVYIGLATLGGSLAIGLSAGLLAPVIGLGIAGGLTTVGISGTSGFLAGVGGSAI
FT                   ITTGGIVTGAKVGSKAGARRLGDVNTFELKPLYNTKRTNLIITVSGWMNGKMDDVRLPF
FT                   STVDPVMGDMFSLLWEPEMLQSMGQTIGILATEALSTSIQQILGATVLSALMAAIQVPM
FT                   VLSKLTYLLDNPWSVSLDRAWKGGKILADTLISGNMGVRPITLVGFSLGARLIYSCLIE
FT                   LAKRGGYGLIENVIILGCPITIKNDQLGLARSVVSGRFVNGFSKRDWILGYLFRATGGG
FT                   ISSVAGLSPIESVYGIENIDCTDIVEGHMAYRKAMPKILKAVNWEILSEEFAEIEEPDP
FT                   EQHERERKLVDEFDEARAKMKEEMDTEANKKKTWKNFFKPNQKDWWNVYSEGKSKGSDA
FT                   NEPYADPSAESNQPHTQTNNPIFDVTALLEEANNIERLADNDPETLKTMRKEVDTSAKH
FT                   TKLNEEVEEEEKSTSIVNSLANKFGVKQDADPGTKD"
     MDFKRTPSVD SLGTAHSVYS SKTPTRSRSN IGSRTSISVL PSLPTNVSNE SIEEDLHNHS        60
     NIDEKLEREA TPETSYVEFD LSSMDQKNSR NDSNFLSEKI ISPNTHRTDI SDVEADKDEV       120
     SDVAKKPEDA ENDFFDMKTS DWKSMKTITE QDYYNDKGEL EYKHANEFDP SKIKFDAHGY       180
     TKIDTEEQVT KYAELDKKTD FLFQSRREIN KKTEAAAYRK EDLDYASDED NSEYEDDDNL       240
     DSNETLQTMR NMLTDGQKFA YVGTTKLIAI DMATELAKIK QSTSNKVAKE LSLGQRNFAN       300
     WTMYITSKLY EHMNLSKDEQ NMIENLSKHG VEVTDLCSSL NQREIIKPSK QNQTQENETD       360
     DSMKEIKGKT DNNEVAVDLR WTIICDLLLL LLSDGYYDSR SRSLLVQFAE KMSISHLEIL       420
     QFERRLIESL EIDTNNKSIE NKDEKLNDRE FIDKYKKKNK KKRYVYIGLA TLGGSLAIGL       480
     SAGLLAPVIG LGIAGGLTTV GISGTSGFLA GVGGSAIITT GGIVTGAKVG SKAGARRLGD       540
     VNTFELKPLY NTKRTNLIIT VSGWMNGKMD DVRLPFSTVD PVMGDMFSLL WEPEMLQSMG       600
     QTIGILATEA LSTSIQQILG ATVLSALMAA IQVPMVLSKL TYLLDNPWSV SLDRAWKGGK       660
     ILADTLISGN MGVRPITLVG FSLGARLIYS CLIELAKRGG YGLIENVIIL GCPITIKNDQ       720
     LGLARSVVSG RFVNGFSKRD WILGYLFRAT GGGISSVAGL SPIESVYGIE NIDCTDIVEG       780
     HMAYRKAMPK ILKAVNWEIL SEEFAEIEEP DPEQHERERK LVDEFDEARA KMKEEMDTEA       840
     NKKKTWKNFF KPNQKDWWNV YSEGKSKGSD ANEPYADPSA ESNQPHTQTN NPIFDVTALL       900
     EEANNIERLA DNDPETLKTM RKEVDTSAKH TKLNEEVEEE EKSTSIVNSL ANKFGVKQDA       960
     DPGTKD                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page