(data stored in ACNUC6288 zone)

EMBL: CR382138.PE329

CR382138.PE329       Location/Qualifiers
FT   CDS             complement(665238..666302)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07656g"
FT                   /old_locus_tag="DEHA0F08481g"
FT                   /old_locus_tag="DEHA-IPF8462"
FT                   /old_locus_tag="DEHA-CDS3629.1"
FT                   /product="DEHA2F07656p"
FT                   /note="similar to uniprot|P53686 Saccharomyces cerevisiae
FT                   YPL015C HST2 Cytoplasmic member of the silencing
FT                   information regulator 2 (Sir2) family of NAD(+)-dependent
FT                   protein deacetylases"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07656g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89029"
FT                   /db_xref="GOA:Q6BM81"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR017328"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM81"
FT                   /protein_id="CAG89029.2"
FT                   /translation="MNQLTKILEPIAKAIQAGDKKVTFFEGAGISTAAGIPDFRSPDTG
FT                   LYSNLAKLDLPYAEAVFDIDYFKENPKAFYTLAHELYPGKFMPTKFHYLLRLFQDKKLL
FT                   KRVYTQNIDTLERVAGIEDEYIVEAHGSFARNHCIECSLEMSTEELKKQMSDKSVNDGI
FT                   PICQECGGYVKPDIVFFGEALPVKFFDTWDEDADEVEIAIVAGTSLTVYPFASLPSETT
FT                   KKSLRLLINNEVVGDFKHGKRKTDILAISDCDEAAVTLAELLGWSEELDELINKNKTLF
FT                   ESTYSIGEKTNDEEVSKKSLSKASERLAEEIRDVEAEKGTQKPEKTDKQTESKEEKSKN
FT                   DTDDLEKDISNLKI"
     MNQLTKILEP IAKAIQAGDK KVTFFEGAGI STAAGIPDFR SPDTGLYSNL AKLDLPYAEA        60
     VFDIDYFKEN PKAFYTLAHE LYPGKFMPTK FHYLLRLFQD KKLLKRVYTQ NIDTLERVAG       120
     IEDEYIVEAH GSFARNHCIE CSLEMSTEEL KKQMSDKSVN DGIPICQECG GYVKPDIVFF       180
     GEALPVKFFD TWDEDADEVE IAIVAGTSLT VYPFASLPSE TTKKSLRLLI NNEVVGDFKH       240
     GKRKTDILAI SDCDEAAVTL AELLGWSEEL DELINKNKTL FESTYSIGEK TNDEEVSKKS       300
     LSKASERLAE EIRDVEAEKG TQKPEKTDKQ TESKEEKSKN DTDDLEKDIS NLKI             354
//

If you have problems or comments...

PBIL Back to PBIL home page