(data stored in ACNUC6288 zone)

EMBL: CR382138.PE335

CR382138.PE335       Location/Qualifiers
FT   CDS             complement(676207..679980)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07788g"
FT                   /old_locus_tag="DEHA0F08679g"
FT                   /old_locus_tag="DEHA-IPF8451"
FT                   /old_locus_tag="DEHA-CDS0198.1"
FT                   /product="DEHA2F07788p"
FT                   /note="weakly similar to uniprot|P39523 Saccharomyces
FT                   cerevisiae YMR124W Protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07788g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89038"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM72"
FT                   /protein_id="CAG89038.2"
FT                   /translation="MDSEMASTATQKGKLRQRLLNSELDINVLNEQQQPKIPMQQQMAM
FT                   EQGGGVYQQQYPQAYPQAYVANGAQSQPSFLNSYESLTNQGANEGVRKASLTSQSNMTM
FT                   NKFFRRNKGDGGFDEETGADINDLTNGSNVSFDDISHIRDRGKYGVNGPHLDSTPFIPT
FT                   IGGGIGSASGKSLNNIQYRKQMNHQKKMAYASNARAMSLAGSNPMQQTSDPRAMSLSSF
FT                   GNGNGPRAMSLNSNGMMANGPRAMSLNNRMPMPPPGKGGYMPQNGPRTMSMRNNGAPFG
FT                   NGPYMQPTGGPRAMSLTNGPPGPRAMSLTNGNPMNQQYTPRPHPQQMQQMQQLNPQQMQ
FT                   QMQHMQHMQQMQQMQQSNPQQYGGYQTMNPNARAMSLNGGNPMNDPRFNHAGQFSNSQQ
FT                   RQNMPHPMPNGPNPNMAPEPNQNYAQKSNDSLMNVLEEEDENNTNSPKENQVVSSNRRE
FT                   NNGDNTIDDDDVVYKFDEHDDAGSLSRKSTLKKSNSMKLRKLNLFNSETREQPDIQETS
FT                   FDESPNESRRLSHSSQTLHNTGNDVSPSFNLRKARGARESMLNDASNEEDLAQLDERQE
FT                   KFKSLGANAEYNGSIANSLNKDVFVTANDLISPSKVGKGDNNKKSPLLKNTGYEDINEN
FT                   EENYMKNDNDMLKRRGSPEPISNSTLPNDAHSNMLSKQPSIRSLVTNTAFDKFRESPRK
FT                   SSKTLPELPASPTNSDYGTNATNTTNEDLNSEGSFSQPKQMLDETSNYSSLSSLVQSQN
FT                   NANPTSFERANINAEPLASQQASDQSISSTPRDNNENSTPPTTHNSNISNTNYNDKAQT
FT                   VDSNVAQVYPKTEGKDPSNERRMSAIRNMNTSDMLSSPIVDDNIFAPESARKERRSSKT
FT                   FSLSNKSKNIFKRFSKSGKKSADEDESFTNDEVSFNSNRNSIHSYNQGGIQARKASSAS
FT                   IGQSRPEKPLKFTKEELGIMNCNSELLNDLQLVTTELASSIKRELEFANRLKNNSSSPL
FT                   ESSDELRSQLLGKARVISDLQDKLNKERSLRFICEEHALLAENGTSPSPLKLNYEKTEL
FT                   YKQLLIKNDLVNQLQDKIEESQMKQNPGDSNLLIKYNELLEENTDLKSKVIPDLENRIE
FT                   ASRNVSSLNNNKSLNLVNNCTDHDNANSRGDYDEDYYDDEYDQSREHIEISTLKNQREE
FT                   LREVVSKLSSSYNYELKLAQEKIKNLELKVQDMNSINNKLSQRLEPNRTISSGQNNHNN
FT                   TSNSPLKILSNNKGGKLQGFAIVSPTKKLFDD"
     MDSEMASTAT QKGKLRQRLL NSELDINVLN EQQQPKIPMQ QQMAMEQGGG VYQQQYPQAY        60
     PQAYVANGAQ SQPSFLNSYE SLTNQGANEG VRKASLTSQS NMTMNKFFRR NKGDGGFDEE       120
     TGADINDLTN GSNVSFDDIS HIRDRGKYGV NGPHLDSTPF IPTIGGGIGS ASGKSLNNIQ       180
     YRKQMNHQKK MAYASNARAM SLAGSNPMQQ TSDPRAMSLS SFGNGNGPRA MSLNSNGMMA       240
     NGPRAMSLNN RMPMPPPGKG GYMPQNGPRT MSMRNNGAPF GNGPYMQPTG GPRAMSLTNG       300
     PPGPRAMSLT NGNPMNQQYT PRPHPQQMQQ MQQLNPQQMQ QMQHMQHMQQ MQQMQQSNPQ       360
     QYGGYQTMNP NARAMSLNGG NPMNDPRFNH AGQFSNSQQR QNMPHPMPNG PNPNMAPEPN       420
     QNYAQKSNDS LMNVLEEEDE NNTNSPKENQ VVSSNRRENN GDNTIDDDDV VYKFDEHDDA       480
     GSLSRKSTLK KSNSMKLRKL NLFNSETREQ PDIQETSFDE SPNESRRLSH SSQTLHNTGN       540
     DVSPSFNLRK ARGARESMLN DASNEEDLAQ LDERQEKFKS LGANAEYNGS IANSLNKDVF       600
     VTANDLISPS KVGKGDNNKK SPLLKNTGYE DINENEENYM KNDNDMLKRR GSPEPISNST       660
     LPNDAHSNML SKQPSIRSLV TNTAFDKFRE SPRKSSKTLP ELPASPTNSD YGTNATNTTN       720
     EDLNSEGSFS QPKQMLDETS NYSSLSSLVQ SQNNANPTSF ERANINAEPL ASQQASDQSI       780
     SSTPRDNNEN STPPTTHNSN ISNTNYNDKA QTVDSNVAQV YPKTEGKDPS NERRMSAIRN       840
     MNTSDMLSSP IVDDNIFAPE SARKERRSSK TFSLSNKSKN IFKRFSKSGK KSADEDESFT       900
     NDEVSFNSNR NSIHSYNQGG IQARKASSAS IGQSRPEKPL KFTKEELGIM NCNSELLNDL       960
     QLVTTELASS IKRELEFANR LKNNSSSPLE SSDELRSQLL GKARVISDLQ DKLNKERSLR      1020
     FICEEHALLA ENGTSPSPLK LNYEKTELYK QLLIKNDLVN QLQDKIEESQ MKQNPGDSNL      1080
     LIKYNELLEE NTDLKSKVIP DLENRIEASR NVSSLNNNKS LNLVNNCTDH DNANSRGDYD      1140
     EDYYDDEYDQ SREHIEISTL KNQREELREV VSKLSSSYNY ELKLAQEKIK NLELKVQDMN      1200
     SINNKLSQRL EPNRTISSGQ NNHNNTSNSP LKILSNNKGG KLQGFAIVSP TKKLFDD         1257
//

If you have problems or comments...

PBIL Back to PBIL home page