(data stored in ACNUC6288 zone)

EMBL: CR382138.PE337

CR382138.PE337       Location/Qualifiers
FT   CDS             complement(680935..681375)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07832g"
FT                   /old_locus_tag="DEHA0F08723g"
FT                   /old_locus_tag="DEHA-IPF8446"
FT                   /old_locus_tag="DEHA-CDS6170.1"
FT                   /product="DEHA2F07832p"
FT                   /note="weakly similar to uniprot|Q12091 Saccharomyces
FT                   cerevisiae YPL170W DAP1 Heme-binding protein involved in
FT                   regulation of cytochrome P450 protein Erg11p"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07832g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89040"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM71"
FT                   /protein_id="CAG89040.2"
FT                   /translation="MSSLDTSHQHGVSEKTPNEFEKLNNGINIKMLPIYTRSQLSLYNG
FT                   IDKPEVYVAIKGYIYDVSNNVSNYGPGRPYHKLVGKDVSRLLGLNQLQLKRTGDPYAPE
FT                   KDNAWYTGDFTDKENSIVDKWVLFFRKRYTIVGVVVDHEVGT"
     MSSLDTSHQH GVSEKTPNEF EKLNNGINIK MLPIYTRSQL SLYNGIDKPE VYVAIKGYIY        60
     DVSNNVSNYG PGRPYHKLVG KDVSRLLGLN QLQLKRTGDP YAPEKDNAWY TGDFTDKENS       120
     IVDKWVLFFR KRYTIVGVVV DHEVGT                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page