(data stored in ACNUC6288 zone)

EMBL: CR382138.PE346

CR382138.PE346       Location/Qualifiers
FT   CDS             694025..694885
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08030g"
FT                   /old_locus_tag="IPF_8433"
FT                   /product="DEHA2F08030p"
FT                   /note="similar to uniprot|P36144 Saccharomyces cerevisiae
FT                   YKR060W UTP30 Possible U3 snoRNP protein involved in
FT                   maturation of pre-18S rRNA based on computational analysis
FT                   of large-scale protein-protein interaction data"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08030g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89049"
FT                   /db_xref="GOA:Q6BM62"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM62"
FT                   /protein_id="CAG89049.1"
FT                   /translation="MVSSFILGQSALADGTKSAKSLASHIGKENGPTHHEAVYLIINTK
FT                   IYLTKIKDYTPRIIPLSKGLDKLENKSVLLVTKDPSLPYRDALTKKDSPTEDVFNQIYT
FT                   LTKLKHISKDPKKLTKLFKEFDIIVADNRVHKFLPDILGARFYVKNKKIPFMVQMAKPD
FT                   KDARLSKGKKSTKLKDDRCEPEYVRYQMKSIVRNASYIPSATGTCISVKIGYSDWKPEE
FT                   LLTNANDVIKYLVEPKFLPVGGLLRTPKNLVSVHIKTSESISLPIFKQKEDIKEEDDDD
FT                   SDLDF"
     MVSSFILGQS ALADGTKSAK SLASHIGKEN GPTHHEAVYL IINTKIYLTK IKDYTPRIIP        60
     LSKGLDKLEN KSVLLVTKDP SLPYRDALTK KDSPTEDVFN QIYTLTKLKH ISKDPKKLTK       120
     LFKEFDIIVA DNRVHKFLPD ILGARFYVKN KKIPFMVQMA KPDKDARLSK GKKSTKLKDD       180
     RCEPEYVRYQ MKSIVRNASY IPSATGTCIS VKIGYSDWKP EELLTNANDV IKYLVEPKFL       240
     PVGGLLRTPK NLVSVHIKTS ESISLPIFKQ KEDIKEEDDD DSDLDF                      286
//

If you have problems or comments...

PBIL Back to PBIL home page