(data stored in ACNUC6288 zone)

EMBL: CR382138.PE347

CR382138.PE347       Location/Qualifiers
FT   CDS             695292..697073
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08052g"
FT                   /old_locus_tag="DEHA0F08943g"
FT                   /old_locus_tag="DEHA-IPF8432"
FT                   /old_locus_tag="DEHA-CDS1669.1"
FT                   /product="DEHA2F08052p"
FT                   /note="similar to uniprot|P36029 Saccharomyces cerevisiae
FT                   YKL174C TPO5 Protein involved in excretion of putrescine
FT                   and spermidine"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08052g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89050"
FT                   /db_xref="GOA:Q6BM61"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM61"
FT                   /protein_id="CAG89050.2"
FT                   /translation="MENSQSLGSTSQNASSGGSKPIRTSISSFTNHFNLRKSAPGKLLN
FT                   SLMHDMEDQEVEIEHFKYKQELERKLSVTSVIGLGFGIVGVVFGLSSTIWISLIDGANV
FT                   TILYGWVITAFFSTCVVLSLSEIVSKYPTSGGVYHFSALLSNEKYSSVCSWFTGWFLII
FT                   GNWTYAVSIMFAGSQFILSIFGLKDAYYKEDAFLVLAVYFTLLTFCGFVNFKFAKFLEK
FT                   INKVCIIWSISTVLTIDFLLIFFAKKTNSIEEILTRFDNTRSGWPDPLAFMVGLQSPSF
FT                   TLSGYGMIYSMTDEVKNPERNMPKGTISAILLAGLTGIIFIIPILTILPELTLLLDETP
FT                   EIMPIDLIFKFATESYLISFLLVLLLVGTVFFQAIAALTTASRTTYAFARDGGLPFKNY
FT                   WVEVNSIEESIIPKNALFLSMSVCGALSLLSLFSSSAFNAFMGSSVISLALANGIPILC
FT                   LMLNKRKKIHGAAFRLKGFGWLVNGLSIFWVVLSFIILCLPPVIKDLTWFTMNYAIVVI
FT                   LGFAGFASLGYRIWGVGSFEGPQIDHDYFELQDLVRKDFSVDDSYVQGIDDQDDDDNAI
FT                   AGSSDVQTDLDKPNEGP"
     MENSQSLGST SQNASSGGSK PIRTSISSFT NHFNLRKSAP GKLLNSLMHD MEDQEVEIEH        60
     FKYKQELERK LSVTSVIGLG FGIVGVVFGL SSTIWISLID GANVTILYGW VITAFFSTCV       120
     VLSLSEIVSK YPTSGGVYHF SALLSNEKYS SVCSWFTGWF LIIGNWTYAV SIMFAGSQFI       180
     LSIFGLKDAY YKEDAFLVLA VYFTLLTFCG FVNFKFAKFL EKINKVCIIW SISTVLTIDF       240
     LLIFFAKKTN SIEEILTRFD NTRSGWPDPL AFMVGLQSPS FTLSGYGMIY SMTDEVKNPE       300
     RNMPKGTISA ILLAGLTGII FIIPILTILP ELTLLLDETP EIMPIDLIFK FATESYLISF       360
     LLVLLLVGTV FFQAIAALTT ASRTTYAFAR DGGLPFKNYW VEVNSIEESI IPKNALFLSM       420
     SVCGALSLLS LFSSSAFNAF MGSSVISLAL ANGIPILCLM LNKRKKIHGA AFRLKGFGWL       480
     VNGLSIFWVV LSFIILCLPP VIKDLTWFTM NYAIVVILGF AGFASLGYRI WGVGSFEGPQ       540
     IDHDYFELQD LVRKDFSVDD SYVQGIDDQD DDDNAIAGSS DVQTDLDKPN EGP              593
//

If you have problems or comments...

PBIL Back to PBIL home page