(data stored in ACNUC6288 zone)

EMBL: CR382138.PE350

CR382138.PE350       Location/Qualifiers
FT   CDS             complement(701221..702315)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08118g"
FT                   /old_locus_tag="IPF_8425"
FT                   /product="DEHA2F08118p"
FT                   /note="similar to uniprot|Q7S4H9 Neurospora crassa NCU08171
FT                   Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08118g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66299"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUC1"
FT                   /protein_id="CAR66299.1"
FT                   /translation="MRLLSFVIILSWISWVVAESCTGEQKLNLEDFQFVEHSNENLDGL
FT                   SEKLKSREVSLTKVIEDGNHKLTKASPWEYSAVKDAIQWESKDGFDDLNTKKWVPQGIS
FT                   SSADAYDKGDWNGKEAWIVSWHNEDDTSVRVTFVDKETNKYRHVLLVYPTAKDDFGPVQ
FT                   IHAGGIAWYGDKLYVVDTDIGLRMFDLSTIWEVDDGSKIGKDGTKYTAASYKYVIPQIS
FT                   YYKLTPQRDFKFSYVALDRTSTPYSLIVGEYRTASSGKKTRLVKWNLDSENRKLKSKTA
FT                   SFGYCIGQPRMQGAVSVGEKVYISVSNEKNPGDLYTWTAGSKPKRESSFFPPSPEDLAY
FT                   NKHGNELYGLTEGIGKRYILTYGL"
     MRLLSFVIIL SWISWVVAES CTGEQKLNLE DFQFVEHSNE NLDGLSEKLK SREVSLTKVI        60
     EDGNHKLTKA SPWEYSAVKD AIQWESKDGF DDLNTKKWVP QGISSSADAY DKGDWNGKEA       120
     WIVSWHNEDD TSVRVTFVDK ETNKYRHVLL VYPTAKDDFG PVQIHAGGIA WYGDKLYVVD       180
     TDIGLRMFDL STIWEVDDGS KIGKDGTKYT AASYKYVIPQ ISYYKLTPQR DFKFSYVALD       240
     RTSTPYSLIV GEYRTASSGK KTRLVKWNLD SENRKLKSKT ASFGYCIGQP RMQGAVSVGE       300
     KVYISVSNEK NPGDLYTWTA GSKPKRESSF FPPSPEDLAY NKHGNELYGL TEGIGKRYIL       360
     TYGL                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page