(data stored in ACNUC6288 zone)

EMBL: CR382138.PE355

CR382138.PE355       Location/Qualifiers
FT   CDS             join(713634..713942,714016..714264)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08228g"
FT                   /old_locus_tag="DEHA0F09119g"
FT                   /old_locus_tag="DEHA-IPF8412"
FT                   /old_locus_tag="DEHA-CDS6884.1"
FT                   /product="DEHA2F08228p"
FT                   /note="highly similar to uniprot|P46990 Saccharomyces
FT                   cerevisiae YJL177W RPL17B Protein component of the large
FT                   (60S) ribosomal subunit nearly identical to Rpl17Ap and has
FT                   similarity to E. coli L22 and rat L17 ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08228g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89058"
FT                   /db_xref="GOA:Q6BM53"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005721"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BM53"
FT                   /protein_id="CAG89058.1"
FT                   /translation="MVRYAATSANPAKSASARGSYLRVSYKNTRETAQAISGWKLERAQ
FT                   KYLDQVLDHQRAIPFRRFNSSIGRTGQGKEFGVTKARWPAKSVNFIKDLLRNGQANAES
FT                   KGLDASKLKVSHIQVNQAPKQRRRTYRAHGRINAYQSSPCHIELILTEENEAVEKADDS
FT                   KKVRLNVRQRGRLATQKRVTAA"
     MVRYAATSAN PAKSASARGS YLRVSYKNTR ETAQAISGWK LERAQKYLDQ VLDHQRAIPF        60
     RRFNSSIGRT GQGKEFGVTK ARWPAKSVNF IKDLLRNGQA NAESKGLDAS KLKVSHIQVN       120
     QAPKQRRRTY RAHGRINAYQ SSPCHIELIL TEENEAVEKA DDSKKVRLNV RQRGRLATQK       180
     RVTAA                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page