(data stored in ACNUC6288 zone)

EMBL: CR382138.PE361

CR382138.PE361       Location/Qualifiers
FT   CDS             721912..723375
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08360g"
FT                   /old_locus_tag="DEHA0F09251g"
FT                   /old_locus_tag="DEHA-IPF8402"
FT                   /old_locus_tag="DEHA-CDS2433.1"
FT                   /product="DEHA2F08360p"
FT                   /note="highly similar to uniprot|Q9UUU2 Yarrowia lipolytica
FT                   YALI0B20372g nubm NUBM protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08360g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89064"
FT                   /db_xref="GOA:Q6BM47"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011537"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM47"
FT                   /protein_id="CAG89064.1"
FT                   /translation="MIHNLKTQQRSLRRGLATIADATNPNRVHGGLKDQDRIFQNVYNK
FT                   YGHDLKSAQKMGDWYKTKEIILKGDKWIIDEMKKSGLRGRGGAGFPSGLKWSFMNPPGW
FT                   EKNPGPRYLVVNADEGEPGTCKDREIIRKDPHKLVEGCLLAGRAMNATAAYIYIRGEFY
FT                   NEAVILQQAINEAYKEGLIGKNACGSGYDFDVYIHRGMGAYICGEETALIESLEGKAGK
FT                   PRLKPPFPAGVGLFGRPSTVTNVETVAVAPTILRRGGDWFASFGRKNNTGTKLFCISGH
FT                   VNEPCTVEEEMSIPLKELLEKHCGGVKGGWDNLLGVIPGGCSVPVMPKSVCDDIAMDYD
FT                   ALRDVGSGLGTAAVIVMNKETDMIRAIQRFAAFYKHESCGQCTPCREGTTWLQKMMDRF
FT                   VKGQATEKEIDMIFELTKEIEGHTICALGDAAAWPIQGLIKSFRPLMVDRIKQYEQESQ
FT                   CSVSYGGWVKGGKVKEGKVIDNPLPSAHH"
     MIHNLKTQQR SLRRGLATIA DATNPNRVHG GLKDQDRIFQ NVYNKYGHDL KSAQKMGDWY        60
     KTKEIILKGD KWIIDEMKKS GLRGRGGAGF PSGLKWSFMN PPGWEKNPGP RYLVVNADEG       120
     EPGTCKDREI IRKDPHKLVE GCLLAGRAMN ATAAYIYIRG EFYNEAVILQ QAINEAYKEG       180
     LIGKNACGSG YDFDVYIHRG MGAYICGEET ALIESLEGKA GKPRLKPPFP AGVGLFGRPS       240
     TVTNVETVAV APTILRRGGD WFASFGRKNN TGTKLFCISG HVNEPCTVEE EMSIPLKELL       300
     EKHCGGVKGG WDNLLGVIPG GCSVPVMPKS VCDDIAMDYD ALRDVGSGLG TAAVIVMNKE       360
     TDMIRAIQRF AAFYKHESCG QCTPCREGTT WLQKMMDRFV KGQATEKEID MIFELTKEIE       420
     GHTICALGDA AAWPIQGLIK SFRPLMVDRI KQYEQESQCS VSYGGWVKGG KVKEGKVIDN       480
     PLPSAHH                                                                 487
//

If you have problems or comments...

PBIL Back to PBIL home page