(data stored in ACNUC6288 zone)

EMBL: CR382138.PE366

CR382138.PE366       Location/Qualifiers
FT   CDS             complement(728006..733777)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08470g"
FT                   /old_locus_tag="IPF_8394"
FT                   /product="DEHA2F08470p"
FT                   /note="similar to uniprot|P32333 Saccharomyces cerevisiae
FT                   YPL082C MOT1 Essential abundant protein involved in
FT                   regulation of transcription removes Spt15p (TBP) from DNA
FT                   via its C-terminal ATPase activity forms a complex with TBP
FT                   that binds TATA DNA with high affinity but with altered
FT                   specificity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08470g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66304"
FT                   /db_xref="GOA:B5RUC6"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR022707"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUC6"
FT                   /protein_id="CAR66304.1"
FT                   /translation="MSRLDRLVVLLETGSTPFIRNTAADQLSDLAKGHPEETINLLGRV
FT                   YPYLKSTKWETRVTAARAFGGIVNHSELWDPNCSDTIKKEHEFEEKEETIVKIEELDEA
FT                   SRIKLEQDEELKKIDDNLSNLVDFNSWNLHEILKSNVKLLACGTDEFEPSNGTGQHPDD
FT                   NSTFIGKLKKQKSNITPVEETEVKPDPEVKTEHIEAVSVSCDNSDSNSPRPDSSRTASN
FT                   ARLKAMQKRRAKVNAKSGAIRVKPVDISQSSISRKLVENGEGTDEIMEDSAQYDITSQQ
FT                   GGEKLVFETKAPELSPLLSQHAKVAGLVWQFQGVYELLVADLFDEKWEIRHGSALGLRE
FT                   LIRKHGKGAGRVMNKSKEDNDRNNSATLEDLAVRLCTLFALDRFGDYVSDTVVAPVRES
FT                   SAQTLAALLIHLDDQVVLRTFDSLNKLVLQDHANDLGVPKCWEAKHGGMLGVRYFVSVR
FT                   TDVLLSRPESLDTVVNMVLHGLQESDDDVQSVAALTLTPIASQFVKTKQELIHTLLSVI
FT                   WDCLTNLRDDLSASIGSVMDLLAKLCTHKEVIAIMQKDAIESNSNSFEYLVPRLFPFFR
FT                   HSITNVRKAVLRTILEFLSIGSDVTKKWINSKALRLIFQNLLVEQNKDVLELSVLVYNK
FT                   LLKEIDQNNELESMETIFGCHFQPLLTLLMTPIGIARHNYHMNTNLIMRPSGHILGSLE
FT                   DGSAVSTPIEDDTNLDPLEPNGVEKRGRKRKSPNETKVKSDFPFHEDLKVNIDAPIFKG
FT                   DVMLVGFETFIRTRSEAATAYGNSLSYITNEETLQNIFQLLLHYLSSPHATPRLFSALV
FT                   IQEFANSLKSRDMSPPETAIALFQESLMNVLSNPDNSTLPYYRELVPTLKSVRTSCLQM
FT                   FDAFITSAKVSPTKIPQLPVVVQGENEAGPGAFGLEFAEKIVNETYQKLMKNLSPTYRM
FT                   SANQTLEDSKHRITVAIQEANTARTHRTTGILSVYAAAVLALNGIPKKLNPIIRSLMDS
FT                   VKQEESGILQQRSAIAVAHLIKELNIAGKKGAADKIVKNLCAFLCVDTSEVPEFYHNIK
FT                   FKDYILSLRKEEAKTDPADIAAHERAIIEARIKRNGALMTLEALLSIYKSNLFEEVSKL
FT                   KELMLEPLNLLKISSTNEVIEDVLKGQSIIDALGVLRALLPKLDSSLYPEIIERLPLLI
FT                   PGLSSDFSVFRYSTAKCFATISSICPTKAFTFLVKSILPMLNNAGEVKERQGAIESIYH
FT                   LSSTMGSDILPYIVFLIVPVLGRMSDTDQDVRILATTTFASIIKLVPLEAGIPDPADMP
FT                   QELLEGRDRERDFIQQMMDPTKVKSFDLPVSIKATLRKYQQEGVNWLAFLNKYHLHGIL
FT                   CDDMGLGKTLQTICIVASDHYMRAERFKETQSAEFRRLPSIIICPPSLTGHWEQEYNQY
FT                   APFLKVIVYAGAPSIRSAIRSQIHDADIVVTSYDVCRNDVEFLANHDFNYCVLDEGHII
FT                   KNAASKLTRSVKRIRGEHRLILSGTPIQNNVLELWSLFDFLMPGFLGTEKVFHEKFAKP
FT                   IATSRSSKTSSKEQEAGALALESLHKQVLPFMLRRLKEDVLSDLPPKIIQDYYCELSDL
FT                   QKQLYKDFAKKQKSTVVDEVQSEGDEAKEGKTHVFQALQYMRKLCNHPALVLSPDHPKF
FT                   AEVSTYLQSHKSDIRSIEHSPKLMSLKNLLLECGIGVNDNDYLSANYKQKQKQQQMITS
FT                   EGVISEHRALIFCQLKDMLDIVENELLKKYLPSVTYTRLDGSTDPRDRQSIVRKFNEDP
FT                   SIDVLLLTTKVGGLGLNLTGADTVIFVEHDWNPMNDLQAMDRAHRLGQKKVVNVYRLIT
FT                   KNTLEEKIMGLQKFKMNIASTIVNQQNSGLASMDTNQLLDLFDVDENAAKLVEIGENNT
FT                   DKKEENVPDDVAGGLTGKAAGAVGELADLWDESQYEDEYNLDNFIKTLK"
     MSRLDRLVVL LETGSTPFIR NTAADQLSDL AKGHPEETIN LLGRVYPYLK STKWETRVTA        60
     ARAFGGIVNH SELWDPNCSD TIKKEHEFEE KEETIVKIEE LDEASRIKLE QDEELKKIDD       120
     NLSNLVDFNS WNLHEILKSN VKLLACGTDE FEPSNGTGQH PDDNSTFIGK LKKQKSNITP       180
     VEETEVKPDP EVKTEHIEAV SVSCDNSDSN SPRPDSSRTA SNARLKAMQK RRAKVNAKSG       240
     AIRVKPVDIS QSSISRKLVE NGEGTDEIME DSAQYDITSQ QGGEKLVFET KAPELSPLLS       300
     QHAKVAGLVW QFQGVYELLV ADLFDEKWEI RHGSALGLRE LIRKHGKGAG RVMNKSKEDN       360
     DRNNSATLED LAVRLCTLFA LDRFGDYVSD TVVAPVRESS AQTLAALLIH LDDQVVLRTF       420
     DSLNKLVLQD HANDLGVPKC WEAKHGGMLG VRYFVSVRTD VLLSRPESLD TVVNMVLHGL       480
     QESDDDVQSV AALTLTPIAS QFVKTKQELI HTLLSVIWDC LTNLRDDLSA SIGSVMDLLA       540
     KLCTHKEVIA IMQKDAIESN SNSFEYLVPR LFPFFRHSIT NVRKAVLRTI LEFLSIGSDV       600
     TKKWINSKAL RLIFQNLLVE QNKDVLELSV LVYNKLLKEI DQNNELESME TIFGCHFQPL       660
     LTLLMTPIGI ARHNYHMNTN LIMRPSGHIL GSLEDGSAVS TPIEDDTNLD PLEPNGVEKR       720
     GRKRKSPNET KVKSDFPFHE DLKVNIDAPI FKGDVMLVGF ETFIRTRSEA ATAYGNSLSY       780
     ITNEETLQNI FQLLLHYLSS PHATPRLFSA LVIQEFANSL KSRDMSPPET AIALFQESLM       840
     NVLSNPDNST LPYYRELVPT LKSVRTSCLQ MFDAFITSAK VSPTKIPQLP VVVQGENEAG       900
     PGAFGLEFAE KIVNETYQKL MKNLSPTYRM SANQTLEDSK HRITVAIQEA NTARTHRTTG       960
     ILSVYAAAVL ALNGIPKKLN PIIRSLMDSV KQEESGILQQ RSAIAVAHLI KELNIAGKKG      1020
     AADKIVKNLC AFLCVDTSEV PEFYHNIKFK DYILSLRKEE AKTDPADIAA HERAIIEARI      1080
     KRNGALMTLE ALLSIYKSNL FEEVSKLKEL MLEPLNLLKI SSTNEVIEDV LKGQSIIDAL      1140
     GVLRALLPKL DSSLYPEIIE RLPLLIPGLS SDFSVFRYST AKCFATISSI CPTKAFTFLV      1200
     KSILPMLNNA GEVKERQGAI ESIYHLSSTM GSDILPYIVF LIVPVLGRMS DTDQDVRILA      1260
     TTTFASIIKL VPLEAGIPDP ADMPQELLEG RDRERDFIQQ MMDPTKVKSF DLPVSIKATL      1320
     RKYQQEGVNW LAFLNKYHLH GILCDDMGLG KTLQTICIVA SDHYMRAERF KETQSAEFRR      1380
     LPSIIICPPS LTGHWEQEYN QYAPFLKVIV YAGAPSIRSA IRSQIHDADI VVTSYDVCRN      1440
     DVEFLANHDF NYCVLDEGHI IKNAASKLTR SVKRIRGEHR LILSGTPIQN NVLELWSLFD      1500
     FLMPGFLGTE KVFHEKFAKP IATSRSSKTS SKEQEAGALA LESLHKQVLP FMLRRLKEDV      1560
     LSDLPPKIIQ DYYCELSDLQ KQLYKDFAKK QKSTVVDEVQ SEGDEAKEGK THVFQALQYM      1620
     RKLCNHPALV LSPDHPKFAE VSTYLQSHKS DIRSIEHSPK LMSLKNLLLE CGIGVNDNDY      1680
     LSANYKQKQK QQQMITSEGV ISEHRALIFC QLKDMLDIVE NELLKKYLPS VTYTRLDGST      1740
     DPRDRQSIVR KFNEDPSIDV LLLTTKVGGL GLNLTGADTV IFVEHDWNPM NDLQAMDRAH      1800
     RLGQKKVVNV YRLITKNTLE EKIMGLQKFK MNIASTIVNQ QNSGLASMDT NQLLDLFDVD      1860
     ENAAKLVEIG ENNTDKKEEN VPDDVAGGLT GKAAGAVGEL ADLWDESQYE DEYNLDNFIK      1920
     TLK                                                                    1923
//

If you have problems or comments...

PBIL Back to PBIL home page