(data stored in ACNUC6288 zone)

EMBL: CR382138.PE377

CR382138.PE377       Location/Qualifiers
FT   CDS             complement(751782..752987)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08712g"
FT                   /old_locus_tag="DEHA0F09603g"
FT                   /old_locus_tag="DEHA-IPF8377"
FT                   /old_locus_tag="DEHA-CDS3172.1"
FT                   /product="DEHA2F08712p"
FT                   /note="similar to uniprot|P41338 Saccharomyces cerevisiae
FT                   YPL028W ERG10 Acetyl-CoA C-acetyltransferase (acetoacetyl-
FT                   CoA thiolase) cytosolic enzyme that transfers an acetyl
FT                   group from one acetyl-CoA molecule to another forming
FT                   acetoacetyl-CoA"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08712g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89081"
FT                   /db_xref="GOA:Q6BM30"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM30"
FT                   /protein_id="CAG89081.1"
FT                   /translation="MSSVYIVSTARTPIGAFQGGLSSLTYSDLGSHAVHAALKKVPQIK
FT                   AEDVEEIIFGGVLQANVGQAPARQVALKAGLPESIVATTVNKVCASGMKSIILGAQTIL
FT                   TGTADIVVAGGAESMSNTPYYVPSARGGARYGDAVMVDGVQKDGLLDVYENKLMGVAAE
FT                   KCAKDHSFTRDDQDNFAIGSYTKAADAQNAGKFDNEIAPVTIPGKRGKPDVVVANDEEI
FT                   KNFDEPRLRSARAVFQKENGTVTAPNASSLNDGGAAVILVSEKKLKELNLKPLAKISGW
FT                   GEAARAPIDFTIAPSLAIPKALKHANLSMDDIDFFELNEAFSVVGLANAKICNIPSKKL
FT                   NVYGGAVALGHPLGCSGARIVVTLLSVLAQEGGKIGVAGVCNGGGGASSIIIERFDHDS
FT                   KL"
     MSSVYIVSTA RTPIGAFQGG LSSLTYSDLG SHAVHAALKK VPQIKAEDVE EIIFGGVLQA        60
     NVGQAPARQV ALKAGLPESI VATTVNKVCA SGMKSIILGA QTILTGTADI VVAGGAESMS       120
     NTPYYVPSAR GGARYGDAVM VDGVQKDGLL DVYENKLMGV AAEKCAKDHS FTRDDQDNFA       180
     IGSYTKAADA QNAGKFDNEI APVTIPGKRG KPDVVVANDE EIKNFDEPRL RSARAVFQKE       240
     NGTVTAPNAS SLNDGGAAVI LVSEKKLKEL NLKPLAKISG WGEAARAPID FTIAPSLAIP       300
     KALKHANLSM DDIDFFELNE AFSVVGLANA KICNIPSKKL NVYGGAVALG HPLGCSGARI       360
     VVTLLSVLAQ EGGKIGVAGV CNGGGGASSI IIERFDHDSK L                           401
//

If you have problems or comments...

PBIL Back to PBIL home page