(data stored in ACNUC6288 zone)

EMBL: CR382138.PE396

CR382138.PE396       Location/Qualifiers
FT   CDS             complement(786006..787106)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09152g"
FT                   /old_locus_tag="DEHA0F10065g"
FT                   /old_locus_tag="DEHA-IPF8334"
FT                   /old_locus_tag="DEHA-CDS3507.1"
FT                   /product="DEHA2F09152p"
FT                   /note="similar to uniprot|P50108 Saccharomyces cerevisiae
FT                   YDR245W MNN10 Subunit of a Golgi mannosyltransferase
FT                   complex also containing Anp1p Mnn9p Mnn11p and Hoc1p that
FT                   mediates elongation of the polysaccharide mannan backbone"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09152g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89100"
FT                   /db_xref="GOA:Q6BM12"
FT                   /db_xref="InterPro:IPR008630"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM12"
FT                   /protein_id="CAG89100.2"
FT                   /translation="MSSNQRHTSPKGSVDEDYLEKLESNIHDNNHDNYHKSFKPNKHKS
FT                   LYSRTESLFRSTLKVIQEVCVRHKKIVIVLITLICLSLFTSTPFIPHLRSKDPKVVIIL
FT                   AANEGGGVLKWKGPQEWSVERSSIANKKHYAKVHGYGLTIKDMTLKKRYSHEWRESWEK
FT                   VDIMKQVMRQYPETEWFWWLDLHTYIMEPETSLEQHFLDNLENATYRSLEAFNPLNLPV
FT                   DLPYVDYNSPIDMVITQDCGGFNLGSFMLRRSAWSEMLLDFWWDPAMYEQMHMAWEHNE
FT                   QDALETLYTTQSWIRERIGFLPLRKINAFPPGACSEFSNDPRYFYKERDFVINMAGCEW
FT                   GRDCWGEMEHYKALSKRLHKRWWKFW"
     MSSNQRHTSP KGSVDEDYLE KLESNIHDNN HDNYHKSFKP NKHKSLYSRT ESLFRSTLKV        60
     IQEVCVRHKK IVIVLITLIC LSLFTSTPFI PHLRSKDPKV VIILAANEGG GVLKWKGPQE       120
     WSVERSSIAN KKHYAKVHGY GLTIKDMTLK KRYSHEWRES WEKVDIMKQV MRQYPETEWF       180
     WWLDLHTYIM EPETSLEQHF LDNLENATYR SLEAFNPLNL PVDLPYVDYN SPIDMVITQD       240
     CGGFNLGSFM LRRSAWSEML LDFWWDPAMY EQMHMAWEHN EQDALETLYT TQSWIRERIG       300
     FLPLRKINAF PPGACSEFSN DPRYFYKERD FVINMAGCEW GRDCWGEMEH YKALSKRLHK       360
     RWWKFW                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page