(data stored in ACNUC6288 zone)

EMBL: CR382138.PE405

CR382138.PE405       Location/Qualifiers
FT   CDS             complement(808686..809855)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09372g"
FT                   /old_locus_tag="DEHA0F10285g"
FT                   /old_locus_tag="DEHA-IPF8320"
FT                   /old_locus_tag="DEHA-CDS3273.1"
FT                   /product="DEHA2F09372p"
FT                   /note="similar to uniprot|Q00055 Saccharomyces cerevisiae
FT                   YDL022W GPD1 NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase key enzyme of glycerol synthesis essential
FT                   for growth under osmotic stress"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09372g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89109"
FT                   /db_xref="GOA:Q6BM03"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR017751"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM03"
FT                   /protein_id="CAG89109.1"
FT                   /translation="MSQYRANQRLQQLSNILRPNQLSAEKSLKPETPFKVAVIGSGNWG
FT                   TTIAKVLAENTAEKPDTFAKQVDMWVFQEKIDGTNLTEIINNKHENVKYLPGVKLPENL
FT                   HAEPDIVKAAQGADLLVFNLPHQFLPKICKQLKGTLKPTTRAISCLKGLEVTPDGCKLL
FT                   STYITENLGIECGALSGANLAPEVARCKWSETTVAYNIPADFKGPGKDIDSAVLKEAFH
FT                   RPYFHVNVIEDVAGVSVAGALKNIVAIAVGFVEGLGWGDNAKSAIMRVGLIETINFSNM
FT                   FFPNSKPTTFTHESAGVADLITTCSGGRNVKVGRHMSKTGESAEEAEKKLLNGQSSQGI
FT                   ITAKEVHELLSNVGKTDQFPLFEATYQIIYGDESIQNLPNLLEDHSLFK"
     MSQYRANQRL QQLSNILRPN QLSAEKSLKP ETPFKVAVIG SGNWGTTIAK VLAENTAEKP        60
     DTFAKQVDMW VFQEKIDGTN LTEIINNKHE NVKYLPGVKL PENLHAEPDI VKAAQGADLL       120
     VFNLPHQFLP KICKQLKGTL KPTTRAISCL KGLEVTPDGC KLLSTYITEN LGIECGALSG       180
     ANLAPEVARC KWSETTVAYN IPADFKGPGK DIDSAVLKEA FHRPYFHVNV IEDVAGVSVA       240
     GALKNIVAIA VGFVEGLGWG DNAKSAIMRV GLIETINFSN MFFPNSKPTT FTHESAGVAD       300
     LITTCSGGRN VKVGRHMSKT GESAEEAEKK LLNGQSSQGI ITAKEVHELL SNVGKTDQFP       360
     LFEATYQIIY GDESIQNLPN LLEDHSLFK                                         389
//

If you have problems or comments...

PBIL Back to PBIL home page