(data stored in ACNUC6288 zone)

EMBL: CR382138.PE409

CR382138.PE409       Location/Qualifiers
FT   CDS             complement(815455..815964)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09460g"
FT                   /old_locus_tag="DEHA0F10373g"
FT                   /old_locus_tag="DEHA-IPF8311"
FT                   /old_locus_tag="DEHA-CDS5760.1"
FT                   /product="DEHA2F09460p"
FT                   /note="weakly similar to uniprot|P46964 Saccharomyces
FT                   cerevisiae YOR103C OST2 Epsilon subunit of the
FT                   oligosaccharyltransferase complex of the ER lumen which
FT                   catalyzes asparagine-linked glycosylation of newly
FT                   synthesized proteins"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09460g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89113"
FT                   /db_xref="GOA:Q6BLZ9"
FT                   /db_xref="InterPro:IPR003038"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLZ9"
FT                   /protein_id="CAG89113.1"
FT                   /translation="MAKKDSIKKSVTHTTSNKIGHPINELISAVTTTYKDYINSLTPRL
FT                   KLIDIFLTFLVLLGILQFAYVLLVGNFPFNAFLGGFISCVGQFVLTVSLRLQYNYENNS
FT                   NNTRENIDQEIKEKNIEDVNETKVDIETAEASDMKPFKFVTPERAFGDFIFASLILHFV
FT                   VFHFIN"
     MAKKDSIKKS VTHTTSNKIG HPINELISAV TTTYKDYINS LTPRLKLIDI FLTFLVLLGI        60
     LQFAYVLLVG NFPFNAFLGG FISCVGQFVL TVSLRLQYNY ENNSNNTREN IDQEIKEKNI       120
     EDVNETKVDI ETAEASDMKP FKFVTPERAF GDFIFASLIL HFVVFHFIN                   169
//

If you have problems or comments...

PBIL Back to PBIL home page